Recombinant Human PRSS30P Protein, GST-tagged
| Cat.No. : | PRSS30P-5295H |
| Product Overview : | Human MGC52282 full-length ORF ( Q8IVY7, 1 a.a. - 146 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | PRSS30P (Protease, Serine, 30 Pseudogene) is a Pseudogene. |
| Molecular Mass : | 41.9 kDa |
| AA Sequence : | MRPLQGGREDCGRPRHPGRTLAVAGWPVVDLSGACMWGLPHPPTLGAHSRPLLPEGDSGGPLVCPINDTWIQAGIVSWGFGCARPFRPGVYTQVLSYTDWIQRTLAESHSGMSGARPGAPGSHSGTSRSHPVLLLELLTVCLLGSL |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | PRSS30P protease, serine, 30 pseudogene [ Homo sapiens (human) ] |
| Official Symbol | PRSS30P |
| Synonyms | PRSS30P; protease, serine, 30 pseudogene; protease, serine, 30 homolog, pseudogene; transmembrane protease, serine 8 homolog, pseudogene; transmembrane protease, serine pseudogene |
| Gene ID | 124221 |
| ◆ Recombinant Proteins | ||
| PRSS30P-5295H | Recombinant Human PRSS30P Protein, GST-tagged | +Inquiry |
| PRSS30P-6433HF | Recombinant Full Length Human PRSS30P Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PRSS30P-1106HCL | Recombinant Human PRSS30P cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRSS30P Products
Required fields are marked with *
My Review for All PRSS30P Products
Required fields are marked with *
