Recombinant Full Length Human PRSS8 Protein, GST tagged
Cat.No. : | PRSS8-30709TH |
Product Overview : | Recombinant full length Human PRSS8 with N-terminal proprietary tag. Predicted MW 63.47kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1-343 a.a. |
Description : | This gene encodes a trypsinogen, which is a member of the trypsin family of serine proteases. This enzyme is highly expressed in prostate epithelia and is one of several proteolytic enzymes found in seminal fluid. The proprotein is cleaved to produce a light chain and a heavy chain which are associated by a disulfide bond. It is active on peptide linkages involving the carboxyl group of lysine or arginine. |
Molecular Weight : | 63.470kDa inclusive of tags |
Tissue specificity : | Found in prostate, liver, salivary gland, kidney, lung, pancreas, colon, bronchus and renal proximal tubular cells. In the prostate gland it may be synthesized in epithelial cells, secreted into the ducts, and excreted into the seminal fluid. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MAQKGVLGPGQLGAVAILLYLGLLRSGTGAEGAEAPCGVA PQARITGGSSAVAGQWPWQVSITYEGVHVCGGSLVSEQWV LSAAHCFPSEHHKEAYEVKLGAHQLDSYSEDAKVSTLKDI IPHPSYLQEGSQGDIALLQLSRPITFSRYIRPICLPAANA SFPNGLHCTVTGWGHVAPSVSLLTPKPLQQLEVPLISRET CNCLYNIDAKPEEPHFVQEDMVCAGYVEGGKDACQGDSGG PLSCPVEGLWYLTGIVSWGDACGARNRPGVYTLASSYASW IQSKVTELQPRVVPQTQESQPDSNLCGSHLAFSSAPAQGL LRPILFLPLGLALGLLSPWLSEH |
Sequence Similarities : | Belongs to the peptidase S1 family.Contains 1 peptidase S1 domain. |
Gene Name | PRSS8 protease, serine, 8 [ Homo sapiens ] |
Official Symbol | PRSS8 |
Synonyms | PRSS8; protease, serine, 8; prostasin; |
Gene ID | 5652 |
mRNA Refseq | NM_002773 |
Protein Refseq | NP_002764 |
MIM | 600823 |
Uniprot ID | Q16651 |
Chromosome Location | 16p11.2 |
Function | peptidase activity; serine-type endopeptidase activity; serine-type peptidase activity; sodium channel regulator activity; |
◆ Recombinant Proteins | ||
PRSS8-969R | Recombinant Rat PRSS8 Protein (Met1-Arg322), His-tagged | +Inquiry |
RFL7050RF | Recombinant Full Length Rat Prostasin(Prss8) Protein, His-Tagged | +Inquiry |
Prss8-843M | Recombinant Mouse Prss8 Protein, His-tagged | +Inquiry |
PRSS8-518H | Active Recombinant Human PRSS8 Protein, His-tagged | +Inquiry |
PRSS8-30708TH | Recombinant Human PRSS8 | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRSS8-2865HCL | Recombinant Human PRSS8 cell lysate | +Inquiry |
PRSS8-441MCL | Recombinant Mouse PRSS8 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PRSS8 Products
Required fields are marked with *
My Review for All PRSS8 Products
Required fields are marked with *
0
Inquiry Basket