Recombinant Full Length Human PTGDR Protein
Cat.No. : | PTGDR-411HF |
Product Overview : | Recombinant full length Human Prostaglandin D2 Receptor with N terminal proprietary tag. Predicted MW 65.60 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 359 amino acids |
Description : | The protein encoded by this gene is a G-protein-coupled receptor. It has been shown to function as a prostanoid DP receptor. The activity of this receptor is mainly mediated by G-S proteins that stimulate adenylate cyclase resulting in an elevation of intracellular cAMP and Ca2+.Knockout studies in mice suggest that the ligand of this receptor,prostaglandin D2 (PGD2), functions as a mast cell-derived mediator to trigger asthmatic responses. |
Form : | Liquid |
Molecular Mass : | 65.600kDa inclusive of tags |
AA Sequence : | MKSPFYRCQNTTSVEKGNSAVMGGVLFSTGLLGNLLALGL LARSGLGWCSRRPLRPLPSVFYMLVCGLTVTDLLGKCLLS PVVLAAYAQNRSLRVLAPALDNSLCQAFAFFMSFFGLSST LQLLAMALECWLSLGHPFFYRRHITLRLGALVAPVVSAFS LAFCALPFMGFGKFVQYCPGTWCFIQMVHEEGSLSVLGYS VLYSSLMALLVLATVLCNLGAMRNLYAMHRRLQRHPRSCT RDCAEPRADGREASPQPLEELDHLLLLALMTVLFTMCSLP VIYRAYYGAFKDVKEKNRTSEEAEDLRALRFLSVISIVDP WIFIIFRSPVFRIFFHKIFIRPLRYRSRCSNSTNMESSL |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | PTGDR prostaglandin D2 receptor (DP) [ Homo sapiens ] |
Official Symbol | PTGDR |
Synonyms | PTGDR; prostaglandin D2 receptor (DP); prostaglandin D2 receptor; DP; DP1; PTGDR1 |
Gene ID | 5729 |
mRNA Refseq | NM_000953 |
Protein Refseq | NP_000944 |
MIM | 604687 |
UniProt ID | Q13258 |
◆ Recombinant Proteins | ||
RFL10774MF | Recombinant Full Length Mouse Prostaglandin D2 Receptor(Ptgdr) Protein, His-Tagged | +Inquiry |
PTGDR-4461R | Recombinant Rat PTGDR Protein, His (Fc)-Avi-tagged | +Inquiry |
PTGDR-3232H | Recombinant Human PTGDR protein, His&Myc-tagged | +Inquiry |
RFL10942RF | Recombinant Full Length Rat Prostaglandin D2 Receptor(Ptgdr) Protein, His-Tagged | +Inquiry |
PTGDR-7251M | Recombinant Mouse PTGDR Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PTGDR-2719HCL | Recombinant Human PTGDR 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PTGDR Products
Required fields are marked with *
My Review for All PTGDR Products
Required fields are marked with *