Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at AACR Annual Meeting|Apr. 5-10, 2024|Booth #2953

Recombinant Full Length Human PTGDR Protein

Cat.No. : PTGDR-411HF
Product Overview : Recombinant full length Human Prostaglandin D2 Receptor with N terminal proprietary tag. Predicted MW 65.60 kDa.
  • Specification
  • Gene Information
  • Related Products
Description : The protein encoded by this gene is a G-protein-coupled receptor. It has been shown to function as a prostanoid DP receptor. The activity of this receptor is mainly mediated by G-S proteins that stimulate adenylate cyclase resulting in an elevation of intracellular cAMP and Ca2+.Knockout studies in mice suggest that the ligand of this receptor,prostaglandin D2 (PGD2), functions as a mast cell-derived mediator to trigger asthmatic responses.
Source : In Vitro Cell Free System
Species : Human
Form : Liquid
Molecular Mass : 65.600kDa inclusive of tags
Protein Length : 359 amino acids
AA Sequence : MKSPFYRCQNTTSVEKGNSAVMGGVLFSTGLLGNLLALGL LARSGLGWCSRRPLRPLPSVFYMLVCGLTVTDLLGKCLLS PVVLAAYAQNRSLRVLAPALDNSLCQAFAFFMSFFGLSST LQLLAMALECWLSLGHPFFYRRHITLRLGALVAPVVSAFS LAFCALPFMGFGKFVQYCPGTWCFIQMVHEEGSLSVLGYS VLYSSLMALLVLATVLCNLGAMRNLYAMHRRLQRHPRSCT RDCAEPRADGREASPQPLEELDHLLLLALMTVLFTMCSLP VIYRAYYGAFKDVKEKNRTSEEAEDLRALRFLSVISIVDP WIFIIFRSPVFRIFFHKIFIRPLRYRSRCSNSTNMESSL
Purity : Proprietary Purification
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
Storage Buffer : pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.
Gene Name : PTGDR prostaglandin D2 receptor (DP) [ Homo sapiens ]
Official Symbol : PTGDR
Synonyms : PTGDR; prostaglandin D2 receptor (DP); prostaglandin D2 receptor; DP; DP1; PTGDR1
Gene ID : 5729
mRNA Refseq : NM_000953
Protein Refseq : NP_000944
MIM : 604687
UniProt ID : Q13258

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends