Recombinant Full Length Human PTGDR Protein
Cat.No. : | PTGDR-411HF |
Product Overview : | Recombinant full length Human Prostaglandin D2 Receptor with N terminal proprietary tag. Predicted MW 65.60 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Description : | The protein encoded by this gene is a G-protein-coupled receptor. It has been shown to function as a prostanoid DP receptor. The activity of this receptor is mainly mediated by G-S proteins that stimulate adenylate cyclase resulting in an elevation of intracellular cAMP and Ca2+.Knockout studies in mice suggest that the ligand of this receptor,prostaglandin D2 (PGD2), functions as a mast cell-derived mediator to trigger asthmatic responses. |
Source : | In Vitro Cell Free System |
Species : | Human |
Form : | Liquid |
Molecular Mass : | 65.600kDa inclusive of tags |
Protein Length : | 359 amino acids |
AA Sequence : | MKSPFYRCQNTTSVEKGNSAVMGGVLFSTGLLGNLLALGL LARSGLGWCSRRPLRPLPSVFYMLVCGLTVTDLLGKCLLS PVVLAAYAQNRSLRVLAPALDNSLCQAFAFFMSFFGLSST LQLLAMALECWLSLGHPFFYRRHITLRLGALVAPVVSAFS LAFCALPFMGFGKFVQYCPGTWCFIQMVHEEGSLSVLGYS VLYSSLMALLVLATVLCNLGAMRNLYAMHRRLQRHPRSCT RDCAEPRADGREASPQPLEELDHLLLLALMTVLFTMCSLP VIYRAYYGAFKDVKEKNRTSEEAEDLRALRFLSVISIVDP WIFIIFRSPVFRIFFHKIFIRPLRYRSRCSNSTNMESSL |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name : | PTGDR prostaglandin D2 receptor (DP) [ Homo sapiens ] |
Official Symbol : | PTGDR |
Synonyms : | PTGDR; prostaglandin D2 receptor (DP); prostaglandin D2 receptor; DP; DP1; PTGDR1 |
Gene ID : | 5729 |
mRNA Refseq : | NM_000953 |
Protein Refseq : | NP_000944 |
MIM : | 604687 |
UniProt ID : | Q13258 |
Products Types
◆ Recombinant Protein | ||
PTGDR-7251M | Recombinant Mouse PTGDR Protein, His (Fc)-Avi-tagged | +Inquiry |
PTGDR-3232H | Recombinant Human PTGDR protein, His&Myc-tagged | +Inquiry |
PTGDR-4461R | Recombinant Rat PTGDR Protein, His (Fc)-Avi-tagged | +Inquiry |
PTGDR-4802R | Recombinant Rat PTGDR Protein | +Inquiry |
PTGDR-13634M | Recombinant Mouse PTGDR Protein | +Inquiry |
◆ Lysates | ||
PTGDR-2719HCL | Recombinant Human PTGDR 293 Cell Lysate | +Inquiry |
◆ Assay kits | ||
Kit-1485 | cAMP PTGDR CHO-K1 GPCR Assay Kit | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Reviews
- Q&As
Ask a Question for All PTGDR Products
Required fields are marked with *
My Review for All PTGDR Products
Required fields are marked with *
0
Inquiry Basket