Recombinant Full Length Human PYCR1 Protein, C-Flag-tagged

Cat.No. : PYCR1-1476HFL
Product Overview : Recombinant Full Length Human PYCR1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : This gene encodes an enzyme that catalyzes the NAD(P)H-dependent conversion of pyrroline-5-carboxylate to proline. This enzyme may also play a physiologic role in the generation of NADP(+) in some cell types. The protein forms a homopolymer and localizes to the mitochondrion. Alternative splicing results in multiple transcript variants.
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass : 33.2 kDa
AA Sequence : MSVGFIGAGQLAFALAKGFTAAGVLAAHKIMASSPDMDLATVSALRKMGVKLTPHNKETVQHSDVLFLAV KPHIIPFILDEIGADIEDRHIVVSCAAGVTISSIEKKLSAFRPAPRVIRCMTNTPVVVREGATVYATGTH AQVEDGRLMEQLLSSVGFCTEVEEDLIDAVTGLSGSGPAYAFTALDALADGGVKMGLPRRLAVRLGAQAL LGAAKMLLHSEQHPGQLKDNVSSPGGATIHALHVLESGGFRSLLINAVEASCIRTRELQSMADQEQVSPA
AIKKTILDKVKLDSPAGTALSPSGHTKLLPRSLAPAGKDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Protein Pathways : Arginine and proline metabolism, Metabolic pathways
Full Length : Full L.
Gene Name PYCR1 pyrroline-5-carboxylate reductase 1 [ Homo sapiens (human) ]
Official Symbol PYCR1
Synonyms P5C; P5CR; PRO3; PYCR; PIG45; PP222; ARCL2B; ARCL3B
Gene ID 5831
mRNA Refseq NM_006907.4
Protein Refseq NP_008838.2
MIM 179035
UniProt ID P32322

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PYCR1 Products

Required fields are marked with *

My Review for All PYCR1 Products

Required fields are marked with *

0
cart-icon
0
compare icon