Recombinant Full Length Human QPCT Protein, C-Flag-tagged
Cat.No. : | QPCT-322HFL |
Product Overview : | Recombinant Full Length Human QPCT Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes human pituitary glutaminyl cyclase, which is responsible for the presence of pyroglutamyl residues in many neuroendocrine peptides. The amino acid sequence of this enzyme is 86% identical to that of bovine glutaminyl cyclase. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 37.8 kDa |
AA Sequence : | MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDL QPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACH YDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQ DSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHE LGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKI LQVFVLEYLHLRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Pathways : | Protease |
Full Length : | Full L. |
Gene Name | QPCT glutaminyl-peptide cyclotransferase [ Homo sapiens (human) ] |
Official Symbol | QPCT |
Synonyms | QC; GCT; sQC |
Gene ID | 25797 |
mRNA Refseq | NM_012413.4 |
Protein Refseq | NP_036545.1 |
MIM | 607065 |
UniProt ID | Q16769 |
◆ Recombinant Proteins | ||
QPCT-156H | Recombinant Human QPCT Protein, MYC/DDK-tagged | +Inquiry |
QPCT-322HFL | Recombinant Full Length Human QPCT Protein, C-Flag-tagged | +Inquiry |
QPCT-2139M | Recombinant Mouse QPCT Protein (36-362 aa), His-tagged | +Inquiry |
QPCT-1822H | Recombinant Human QPCT Protein, His (Fc)-Avi-tagged | +Inquiry |
QPCT-8608H | Recombinant Human QPCT protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
QPCT-001HCL | Recombinant Human QPCT cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All QPCT Products
Required fields are marked with *
My Review for All QPCT Products
Required fields are marked with *
0
Inquiry Basket