Recombinant Human QPCT protein, His&Myc-tagged

• Cat.No.: QPCT-7565H
• Product Overview: Recombinant Human QPCT protein(Q16769)(29-361aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in Insect cells.

Specification

• Species: Human
• Source: Insect cells
• Tag: His&Myc
• Protein Length: 29-361aa
• Tag: N-His&C-Myc
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 41.8 kDa
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: VSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL

Gene Information

• Gene Name: QPCT glutaminyl-peptide cyclotransferase [ Homo sapiens ]
• Official Symbol: QPCT
• Synonyms: QPCT; glutaminyl-peptide cyclotransferase; GCT; glutaminyl cyclase; QC; EC; glutamyl cyclase; glutaminyl-tRNA cyclotransferase; sQC
• Gene ID: 25797
• mRNA Refseq: NM_012413
• Protein Refseq: NP_036545
• MIM: 607065
• UniProt ID: Q16769