Recombinant Human QPCT protein, His&Myc-tagged
Cat.No. : | QPCT-7565H |
Product Overview : | Recombinant Human QPCT protein(Q16769)(29-361aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in Insect cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Insect cells |
Tag : | His&Myc |
Protein Length : | 29-361aa |
Tag : | N-His&C-Myc |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 41.8 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | VSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL |
Gene Name | QPCT glutaminyl-peptide cyclotransferase [ Homo sapiens ] |
Official Symbol | QPCT |
Synonyms | QPCT; glutaminyl-peptide cyclotransferase; GCT; glutaminyl cyclase; QC; EC; glutamyl cyclase; glutaminyl-tRNA cyclotransferase; sQC; |
Gene ID | 25797 |
mRNA Refseq | NM_012413 |
Protein Refseq | NP_036545 |
MIM | 607065 |
UniProt ID | Q16769 |
◆ Recombinant Proteins | ||
QPCT-1510H | Recombinant Human QPCT protein, His-tagged | +Inquiry |
QPCT-1347H | Recombinant Human QPCT Protein, His-SUMO-tagged | +Inquiry |
QPCT-8608H | Recombinant Human QPCT protein, His-tagged | +Inquiry |
QPCT-3307H | Recombinant Human QPCT Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
QPCT-7565H | Recombinant Human QPCT protein, His&Myc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
QPCT-001HCL | Recombinant Human QPCT cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All QPCT Products
Required fields are marked with *
My Review for All QPCT Products
Required fields are marked with *