Recombinant Full Length Human R spondin 3 Protein, His tagged

Cat.No. : RSPO3-423H
Product Overview : Recombinant Full Length Human R spondin 3 Protein with His tag was expressed in HEK293.
Availability January 07, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 22-272 aa
Description : This gene belongs to the R-spondin family. The encoded protein plays a role in the regulation of Wnt (wingless-type MMTV integration site family)/beta-catenin and Wnt/planar cell polarity (PCP) signaling pathways, which are involved in development, cell growth and disease pathogenesis. Genome-wide association studies suggest a correlation of this gene with bone mineral density and risk of fracture. This gene may be involved in tumor development.
Tag : C-His
Molecular Mass : 29.45kDa
AA Sequence : QNASRGRRQRRMHPNVSQGCQGGCATCSDYNGCLSCKPRLFFALERIGMKQIGVCLSSCPSGYYGTRYPDINKCTKCKADCDTCFNKNFCTKCKSGFYLHLGKCLDNCPEGLEANNHTMECVSIVHCEVSEWNPWSPCTKKGKTCGFKRGTETRVREIIQHPSAKGNLCPPTNETRKCTVQRKKCQKGERGKKGRERKRKKPNKGESKEAIPDSKSLESSKEIPEQRENKQQQKKRKVQDKQKSVSVSTVHHHHHHHHH
Endotoxin : < 1 EU/μg by LAL
Purity : ≥ 95% by SDS-PAGE
Storage : Store it at -20 centigrade to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. Stable for at least 1 year from receipt of products under proper storage and handling conditions
Storage Buffer : PBS (pH 7.4), 5% trehalose
Concentration : 1 mg/mL
Gene Name RSPO3 R-spondin 3 [ Homo sapiens (human) ]
Official Symbol RSPO3
Synonyms RSPO3; R-spondin 3; PWTSR; THSD2; CRISTIN1; R-spondin-3 R-spondin 3 homolog protein with TSP type-1 repeat roof plate-specific spondin-3 thrombospondin type-1 domain-containing protein 2 thrombospondin, type I, domain containing 2
Gene ID 84870
mRNA Refseq NM_032784
Protein Refseq NP_116173
MIM 610574
UniProt ID Q9BXY4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RSPO3 Products

Required fields are marked with *

My Review for All RSPO3 Products

Required fields are marked with *

0
cart-icon
0
compare icon