Recombinant Full Length Human R spondin 3 Protein, His tagged
Cat.No. : | RSPO3-423H |
Product Overview : | Recombinant Full Length Human R spondin 3 Protein with His tag was expressed in HEK293. |
Availability | May 21, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 22-272 aa |
Description : | This gene belongs to the R-spondin family. The encoded protein plays a role in the regulation of Wnt (wingless-type MMTV integration site family)/beta-catenin and Wnt/planar cell polarity (PCP) signaling pathways, which are involved in development, cell growth and disease pathogenesis. Genome-wide association studies suggest a correlation of this gene with bone mineral density and risk of fracture. This gene may be involved in tumor development. |
Tag : | C-His |
Molecular Mass : | 29.45kDa |
AA Sequence : | QNASRGRRQRRMHPNVSQGCQGGCATCSDYNGCLSCKPRLFFALERIGMKQIGVCLSSCPSGYYGTRYPDINKCTKCKADCDTCFNKNFCTKCKSGFYLHLGKCLDNCPEGLEANNHTMECVSIVHCEVSEWNPWSPCTKKGKTCGFKRGTETRVREIIQHPSAKGNLCPPTNETRKCTVQRKKCQKGERGKKGRERKRKKPNKGESKEAIPDSKSLESSKEIPEQRENKQQQKKRKVQDKQKSVSVSTVHHHHHHHHH |
Endotoxin : | < 1 EU/μg by LAL |
Purity : | ≥ 95% by SDS-PAGE |
Storage : | Store it at -20 centigrade to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. Stable for at least 1 year from receipt of products under proper storage and handling conditions |
Storage Buffer : | PBS (pH 7.4), 5% trehalose |
Concentration : | 1 mg/mL |
Gene Name | RSPO3 R-spondin 3 [ Homo sapiens (human) ] |
Official Symbol | RSPO3 |
Synonyms | RSPO3; R-spondin 3; PWTSR; THSD2; CRISTIN1; R-spondin-3 R-spondin 3 homolog protein with TSP type-1 repeat roof plate-specific spondin-3 thrombospondin type-1 domain-containing protein 2 thrombospondin, type I, domain containing 2 |
Gene ID | 84870 |
mRNA Refseq | NM_032784 |
Protein Refseq | NP_116173 |
MIM | 610574 |
UniProt ID | Q9BXY4 |
◆ Recombinant Proteins | ||
RSPO3-35H | Recombinant Human RSPO3 Protein | +Inquiry |
RSPO3-442H | Active Recombinant Human RSPO3 Protein | +Inquiry |
RSPO3-2455H | Recombinant Human RSPO3, GST-tagged | +Inquiry |
RSPO3-423H | Recombinant Full Length Human R spondin 3 Protein, His tagged | +Inquiry |
RSPO3-1946H | Recombinant Human RSPO3 protein, His & T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RSPO3-1906HCL | Recombinant Human RSPO3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RSPO3 Products
Required fields are marked with *
My Review for All RSPO3 Products
Required fields are marked with *
0
Inquiry Basket