Recombinant Full Length Human RAB3A Protein, C-Flag-tagged
| Cat.No. : | RAB3A-773HFL |
| Product Overview : | Recombinant Full Length Human RAB3A Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Mammalian Cells |
| Tag : | Flag |
| Description : | Enables GTPase activity and myosin V binding activity. Involved in several processes, including acrosomal vesicle exocytosis; lysosome localization; and plasma membrane repair. Located in perinuclear region of cytoplasm. |
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
| Molecular Mass : | 24.8 kDa |
| AA Sequence : | MASATDSRYGQKESSDQNFDYMFKILIIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTIYRNDKR IKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVLLVGNKCDME DERVVSSERGRQLADHLGFEFFEASAKDNINVKQTFERLVDVICEKMSESLDTADPAVTGAKQGPQLSDQ QVPPHQDCACTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80 centigrade. |
| Concentration : | >50 ug/mL as determined by microplate BCA method. |
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Protein Families : | Druggable Genome |
| Full Length : | Full L. |
| Gene Name | RAB3A RAB3A, member RAS oncogene family [ Homo sapiens (human) ] |
| Official Symbol | RAB3A |
| Gene ID | 5864 |
| mRNA Refseq | NM_002866.5 |
| Protein Refseq | NP_002857.1 |
| MIM | 179490 |
| UniProt ID | P20336 |
| ◆ Recombinant Proteins | ||
| RAB3A-7353M | Recombinant Mouse RAB3A Protein, His (Fc)-Avi-tagged | +Inquiry |
| RAB3A-011H | Recombinant Human RAB3A Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
| RAB3A-13819M | Recombinant Mouse RAB3A Protein | +Inquiry |
| RAB3A-305H | Recombinant Human RAB3A Protein, MYC/DDK-tagged | +Inquiry |
| Rab3a-5317M | Recombinant Mouse Rab3a Protein, Myc/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RAB3A Products
Required fields are marked with *
My Review for All RAB3A Products
Required fields are marked with *



