Recombinant Full Length Human RAB3A Protein, C-Flag-tagged
Cat.No. : | RAB3A-773HFL |
Product Overview : | Recombinant Full Length Human RAB3A Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Enables GTPase activity and myosin V binding activity. Involved in several processes, including acrosomal vesicle exocytosis; lysosome localization; and plasma membrane repair. Located in perinuclear region of cytoplasm. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 24.8 kDa |
AA Sequence : | MASATDSRYGQKESSDQNFDYMFKILIIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTIYRNDKR IKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVLLVGNKCDME DERVVSSERGRQLADHLGFEFFEASAKDNINVKQTFERLVDVICEKMSESLDTADPAVTGAKQGPQLSDQ QVPPHQDCACTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Full Length : | Full L. |
Gene Name | RAB3A RAB3A, member RAS oncogene family [ Homo sapiens (human) ] |
Official Symbol | RAB3A |
Gene ID | 5864 |
mRNA Refseq | NM_002866.5 |
Protein Refseq | NP_002857.1 |
MIM | 179490 |
UniProt ID | P20336 |
◆ Recombinant Proteins | ||
RAB3A-1835H | Recombinant Human RAB3A Protein, His (Fc)-Avi-tagged | +Inquiry |
RAB3A-708M | Active Recombinant Full Length Mouse RAB3A Protein, GST/His-tagged | +Inquiry |
RAB3A-3751R | Recombinant Rhesus monkey RAB3A Protein, His-tagged | +Inquiry |
RAB3A-773HFL | Recombinant Full Length Human RAB3A Protein, C-Flag-tagged | +Inquiry |
RAB3A-305H | Recombinant Human RAB3A Protein, MYC/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RAB3A Products
Required fields are marked with *
My Review for All RAB3A Products
Required fields are marked with *