Recombinant Full Length Human RAB7A Protein, C-Flag-tagged
Cat.No. : | RAB7A-435HFL |
Product Overview : | Recombinant Full Length Human RAB7A Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | RAB family members are small, RAS-related GTP-binding proteins that are important regulators of vesicular transport. Each RAB protein targets multiple proteins that act in exocytic / endocytic pathways. This gene encodes a RAB family member that regulates vesicle traffic in the late endosomes and also from late endosomes to lysosomes. This encoded protein is also involved in the cellular vacuolation of the VacA cytotoxin of Helicobacter pylori. Mutations at highly conserved amino acid residues in this gene have caused some forms of Charcot-Marie-Tooth (CMT) type 2 neuropathies. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 23.3 kDa |
AA Sequence : | MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQIWDTAGQERF QSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPFVVLGNKIDLENRQVATKRAQ AWCYSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEVELYNEFPEPIKLDKNDRAKASAESCSC myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Full Length : | Full L. |
Gene Name | RAB7A RAB7A, member RAS oncogene family [ Homo sapiens (human) ] |
Official Symbol | RAB7A |
Synonyms | RAB7; CMT2B; PRO2706 |
Gene ID | 7879 |
mRNA Refseq | NM_004637.6 |
Protein Refseq | NP_004628.4 |
MIM | 602298 |
UniProt ID | P51149 |
◆ Recombinant Proteins | ||
Rab7a-1129R | Recombinant Rat Rab7a protein, His-tagged | +Inquiry |
RAB7A-2649H | Recombinant Full Length Human RAB7A Protein, His-tagged | +Inquiry |
RAB7A-1840H | Recombinant Human RAB7A Protein, His (Fc)-Avi-tagged | +Inquiry |
RAB7A-1118D | Active Recombinant Dog RAB7A, Member RAS Oncogene Family, GST-His | +Inquiry |
RAB7A-435HFL | Recombinant Full Length Human RAB7A Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RAB7A-2583HCL | Recombinant Human RAB7A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RAB7A Products
Required fields are marked with *
My Review for All RAB7A Products
Required fields are marked with *
0
Inquiry Basket