Recombinant Full Length Human RAD51 Protein, C-Flag-tagged
Cat.No. : | RAD51-279HFL |
Product Overview : | Recombinant Full Length Human RAD51 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a member of the RAD51 protein family. RAD51 family members are highly similar to bacterial RecA and Saccharomyces cerevisiae Rad51, and are known to be involved in the homologous recombination and repair of DNA. This protein can interact with the ssDNA-binding protein RPA and RAD52, and it is thought to play roles in homologous pairing and strand transfer of DNA. This protein is also found to interact with BRCA1 and BRCA2, which may be important for the cellular response to DNA damage. BRCA2 is shown to regulate both the intracellular localization and DNA-binding ability of this protein. Loss of these controls following BRCA2 inactivation may be a key event leading to genomic instability and tumorigenesis. Multiple transcript variants encoding different isoforms have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 36.8 kDa |
AA Sequence : | MAMQMQLEANADTSVEEESFGPQPISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELINIKGISEAK ADKILAEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETGSITEMFGEFRTGKTQICHTL AVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGSDVLDNVAYARAFNTDHQTQLLYQASAM MVESRYALLIVDSATALYRTDYSGRGELSARQMHLARFLRMLLRLADEFGVAVVITNQVVAQVDGAAMFA ADPKKPIGGNIIAHASTTRLYLRKGRGETRICKIYDSPCLPEAEAMFAINADGVGDAKDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Stem cell - Pluripotency, Transcription Factors |
Protein Pathways : | Homologous recombination, Pancreatic cancer, Pathways in cancer |
Full Length : | Full L. |
Gene Name | RAD51 RAD51 recombinase [ Homo sapiens (human) ] |
Official Symbol | RAD51 |
Synonyms | RECA; BRCC5; FANCR; MRMV2; HRAD51; RAD51A; HsRad51; HsT16930 |
Gene ID | 5888 |
mRNA Refseq | NM_002875.5 |
Protein Refseq | NP_002866.2 |
MIM | 179617 |
UniProt ID | Q06609 |
◆ Recombinant Proteins | ||
RAD51-134H | Recombinant Human RAD51 | +Inquiry |
RAD51-1121H | Active Recombinant Human RAD51 | +Inquiry |
Rad51-5350M | Recombinant Full Length Mouse Rad51 Protein, Myc/DDK-tagged | +Inquiry |
RAD51-128H | Active Recombinant Human RAD51, His-tagged | +Inquiry |
RAD51-03H | Recombinant Human RAD51 Protein (G151D mutated), Sumo/His/Strep tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RAD51-2556HCL | Recombinant Human RAD51 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RAD51 Products
Required fields are marked with *
My Review for All RAD51 Products
Required fields are marked with *
0
Inquiry Basket