Recombinant Full Length Human Ras-related C3 Botulinum Toxin Substrate 1 / RAC1 Protein, Untagged

Cat.No. : RAC1-189H
Product Overview : Recombinant Human Ras-Related C3 Botulinum Toxin substrate 1 produced inE.Coliis a single, non-glycosylated polypeptide chain. The protein contains 192 amino acids and has a molecular mass of 21.4 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : 1-192 a.a.
Description : RAC1 is a GTPase which belongs to the RAS superfamily of small GTP-binding proteins. Members of this superfamily appear to regulate a diverse array of cellular events, including the control of cell growth, cytoskeletal reorganization, and the activation of protein kinases. RAC-1 regulates the actin cytoskeleton but also other cellular processes. RAC1 have been shown to be involved in the regulation of cell-cell adhesion.
Amino Acid Sequence : MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCP PPVKKRKRKCLLL.
Physical Appearance : Sterile Filtered colorless solution.
Formulation : The protein solution (1mg/ml) cotains 20mM Tris-HCl pH7.5, 2mM EDTA and 1mM DTT.
Purity : Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Stability : RAC1 although stable 14°Cfor 4 weeks, should be stored desiccated below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
Gene Name RAC1 ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1) [ Homo sapiens ]
Synonyms RAC1; MGC111543; MIG5; TC-25; PAK1; TC25; P21-RAC1; RAC-1; p21-Rac1;Ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1); RAS-like protein; Ras-related C3 botulinum toxin substrate 1; rho family; small GTP binding protein Rac1; Ras-related C3 botulinum toxin substrate 1; Cell migration-inducing gene 5 protein; Ras-like protein TC25; migration-inducing gene 5; migration-inducing protein 5; ras-related C3 botulinum toxin substrate 1; ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1); ras-related C3 botulinum toxin substrate 1 isoform Rac1; ras-related C3 botulinum toxin substrate 1 isoform Rac1b; rho family, small GTP binding protein Rac1
Gene ID 5879
mRNA Refseq NM_006908
Protein Refseq NP_008839
MIM 602048
UniProt ID P63000
Chromosome Location 7p22
Pathway Adherens junction; Amyotrophic lateral sclerosis (ALS); Axon guidance; B cell receptor signaling pathway; Chemokine signaling pathway; Colorectal cancer; Epithelial cell signaling in Helicobacter pylori infection; Fc epsilon RI signaling pathway; Fc gamma R-mediated phagocytosis; Focal adhesion; Leukocyte transendothelial migration; MAPK signaling pathway; Natural killer cell mediated cytotoxicity; Neurotrophin signaling pathway; Pancreatic cancer; Regulation of actin cytoskeleton; Renal cell carcinoma; Toll-like receptor signaling pathway; VEGF signaling pathway; Wnt signaling pathway
Function GTP binding; GTP-dependent protein binding; GTPase activity; enzyme binding; nucleotide binding

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RAC1 Products

Required fields are marked with *

My Review for All RAC1 Products

Required fields are marked with *

0
cart-icon