Recombinant Full Length Human Ras-related C3 Botulinum Toxin Substrate 1 / RAC1 Protein, Untagged
| Cat.No. : | RAC1-189H |
| Product Overview : | Recombinant Human Ras-Related C3 Botulinum Toxin substrate 1 produced inE.Coliis a single, non-glycosylated polypeptide chain. The protein contains 192 amino acids and has a molecular mass of 21.4 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | Non |
| Protein Length : | 1-192 a.a. |
| Description : | RAC1 is a GTPase which belongs to the RAS superfamily of small GTP-binding proteins. Members of this superfamily appear to regulate a diverse array of cellular events, including the control of cell growth, cytoskeletal reorganization, and the activation of protein kinases. RAC-1 regulates the actin cytoskeleton but also other cellular processes. RAC1 have been shown to be involved in the regulation of cell-cell adhesion. |
| Amino Acid Sequence : | MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCP PPVKKRKRKCLLL. |
| Physical Appearance : | Sterile Filtered colorless solution. |
| Formulation : | The protein solution (1mg/ml) cotains 20mM Tris-HCl pH7.5, 2mM EDTA and 1mM DTT. |
| Purity : | Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE. |
| Stability : | RAC1 although stable 14°Cfor 4 weeks, should be stored desiccated below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles. |
| Gene Name | RAC1 ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1) [ Homo sapiens ] |
| Synonyms | RAC1; MGC111543; MIG5; TC-25; PAK1; TC25; P21-RAC1; RAC-1; p21-Rac1;Ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1); RAS-like protein; Ras-related C3 botulinum toxin substrate 1; rho family; small GTP binding protein Rac1; Ras-related C3 botulinum toxin substrate 1; Cell migration-inducing gene 5 protein; Ras-like protein TC25; migration-inducing gene 5; migration-inducing protein 5; ras-related C3 botulinum toxin substrate 1; ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1); ras-related C3 botulinum toxin substrate 1 isoform Rac1; ras-related C3 botulinum toxin substrate 1 isoform Rac1b; rho family, small GTP binding protein Rac1 |
| Gene ID | 5879 |
| mRNA Refseq | NM_006908 |
| Protein Refseq | NP_008839 |
| MIM | 602048 |
| UniProt ID | P63000 |
| Chromosome Location | 7p22 |
| Pathway | Adherens junction; Amyotrophic lateral sclerosis (ALS); Axon guidance; B cell receptor signaling pathway; Chemokine signaling pathway; Colorectal cancer; Epithelial cell signaling in Helicobacter pylori infection; Fc epsilon RI signaling pathway; Fc gamma R-mediated phagocytosis; Focal adhesion; Leukocyte transendothelial migration; MAPK signaling pathway; Natural killer cell mediated cytotoxicity; Neurotrophin signaling pathway; Pancreatic cancer; Regulation of actin cytoskeleton; Renal cell carcinoma; Toll-like receptor signaling pathway; VEGF signaling pathway; Wnt signaling pathway |
| Function | GTP binding; GTP-dependent protein binding; GTPase activity; enzyme binding; nucleotide binding |
| ◆ Recombinant Proteins | ||
| RAC1-1105HFL | Recombinant Full Length Human RAC1 Protein, C-Flag-tagged | +Inquiry |
| RAC1-8511H | Recombinant Human RAC1 protein, His-tagged | +Inquiry |
| RAC1-13857M | Recombinant Mouse RAC1 Protein | +Inquiry |
| RAC1-7034H | Recombinant Human RAC1, GST-tagged | +Inquiry |
| RAC1-7379M | Recombinant Mouse RAC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RAC1-712HCL | Recombinant Human RAC1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RAC1 Products
Required fields are marked with *
My Review for All RAC1 Products
Required fields are marked with *



