Recombinant Full Length Human RCN1 Protein, C-Flag-tagged
Cat.No. : | RCN1-2142HFL |
Product Overview : | Recombinant Full Length Human RCN1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Reticulocalbin 1 is a calcium-binding protein located in the lumen of the ER. The protein contains six conserved regions with similarity to a high affinity Ca(+2)-binding motif, the EF-hand. High conservation of amino acid residues outside of these motifs, in comparison to mouse reticulocalbin, is consistent with a possible biochemical function besides that of calcium binding. In human endothelial and prostate cancer cell lines this protein localizes to the plasma membrane. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 35.8 kDa |
AA Sequence : | MARGGRGRRLGLALGLLLALVLAPRVLRAKPTVRKERVVRPDSELGERPPEDNQSFQYDHEAFLGKEDSK TFDQLTPDESKERLGKIVDRIDNDGDGFVTTEELKTWIKRVQKRYIFDNVAKVWKDYDRDKDDKISWEEY KQATYGYYLGNPAEFHDSSDHHTFKKMLPRDERRFKAADLNGDLTATREEFTAFLHPEEFEHMKEIVVLE TLEDIDKNGDGFVDQDEYIADMFSHEENGPEPDWVLSEREQFNEFRDLNKDGKLDKDEIRHWILPQDYDH AQAEARHLVYESDKNKDEKLTKEEILENWNMFVGSQATNYGEDLTKNHDEL myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | RCN1 reticulocalbin 1 [ Homo sapiens (human) ] |
Official Symbol | RCN1 |
Synonyms | RCN; RCAL; PIG20; HEL-S-84 |
Gene ID | 5954 |
mRNA Refseq | NM_002901.4 |
Protein Refseq | NP_002892.1 |
MIM | 602735 |
UniProt ID | Q15293 |
◆ Recombinant Proteins | ||
Rcn1-5438M | Recombinant Mouse Rcn1 Protein, Myc/DDK-tagged | +Inquiry |
RCN1-31305TH | Recombinant Human RCN1, His-tagged | +Inquiry |
RCN1-6631H | Recombinant Human RCN1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RCN1-1869H | Recombinant Human RCN1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Rcn1-6786M | Recombinant Mouse Rcn1 Protein (Lys24-Leu325), N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RCN1-2443HCL | Recombinant Human RCN1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RCN1 Products
Required fields are marked with *
My Review for All RCN1 Products
Required fields are marked with *
0
Inquiry Basket