Recombinant Human RCN1, His-tagged
Cat.No. : | RCN1-31305TH |
Product Overview : | Recombinant full length Human RCN1 with an N terminal His tag; 341 amino acids including tag, Predicted MWt 40.4kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 302 amino acids |
Description : | Reticulocalbin 1 is a calcium-binding protein located in the lumen of the ER. The protein contains six conserved regions with similarity to a high affinity Ca(+2)-binding motif, the EF-hand. High conservation of amino acid residues outside of these motifs, in comparison to mouse reticulocalbin, is consistent with a possible biochemical function besides that of calcium binding. In human endothelial and prostate cancer cell lines this protein localizes to the plasma membrane. |
Conjugation : | HIS |
Molecular Weight : | 40.400kDa inclusive of tags |
Form : | Liquid |
Purity : | by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 10% Glycerol, 20mM Tris HCl, 100mM Sodium chloride, 1mM DTT, pH 8.0 |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSELEKPTVRKERVVRPDSELGERPPEDNQSFQYDHEAFLGKEDSKTFDQLTPDESKERLGKIVDRIDNDGDGFVTTEELKTWIKRVQKRYIFDNVAKVWKDYDRDKDDKISWEEYKQATYGYYLGNPAEFHDSSDHHTFKKMLPRDERRFKAADLNGDLTATREEFTAFLHPEEFEHMKEIVVLETLEDIDKNGDGFVDQDEYIADMFSHEENGPEPDWVLSEREQFNEFRDLNKDGKLDKDEIRHWILPQDYDHAQAEARHLVYESDKNKDEKLTKEEILENWNMFVGSQATNYGEDLTKNHDEL |
Gene Name | RCN1 reticulocalbin 1, EF-hand calcium binding domain [ Homo sapiens ] |
Official Symbol | RCN1 |
Synonyms | RCN1; reticulocalbin 1, EF-hand calcium binding domain; RCN; reticulocalbin-1; FLJ37041; PIG20; proliferation inducing gene 20; Rcal; |
Gene ID | 5954 |
mRNA Refseq | NM_002901 |
Protein Refseq | NP_002892 |
MIM | 602735 |
Uniprot ID | Q15293 |
Chromosome Location | 11p13 |
Function | calcium ion binding; protein binding; |
◆ Recombinant Proteins | ||
RCN1-2753H | Recombinant Human RCN1, His-tagged | +Inquiry |
RCN1-2142HFL | Recombinant Full Length Human RCN1 Protein, C-Flag-tagged | +Inquiry |
RCN1-1869H | Recombinant Human RCN1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RCN1-6631H | Recombinant Human RCN1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Rcn1-5438M | Recombinant Mouse Rcn1 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RCN1-2443HCL | Recombinant Human RCN1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RCN1 Products
Required fields are marked with *
My Review for All RCN1 Products
Required fields are marked with *
0
Inquiry Basket