Recombinant Human RCN1, His-tagged

Cat.No. : RCN1-31305TH
Product Overview : Recombinant full length Human RCN1 with an N terminal His tag; 341 amino acids including tag, Predicted MWt 40.4kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 302 amino acids
Description : Reticulocalbin 1 is a calcium-binding protein located in the lumen of the ER. The protein contains six conserved regions with similarity to a high affinity Ca(+2)-binding motif, the EF-hand. High conservation of amino acid residues outside of these motifs, in comparison to mouse reticulocalbin, is consistent with a possible biochemical function besides that of calcium binding. In human endothelial and prostate cancer cell lines this protein localizes to the plasma membrane.
Conjugation : HIS
Molecular Weight : 40.400kDa inclusive of tags
Form : Liquid
Purity : by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 10% Glycerol, 20mM Tris HCl, 100mM Sodium chloride, 1mM DTT, pH 8.0
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSELEKPTVRKERVVRPDSELGERPPEDNQSFQYDHEAFLGKEDSKTFDQLTPDESKERLGKIVDRIDNDGDGFVTTEELKTWIKRVQKRYIFDNVAKVWKDYDRDKDDKISWEEYKQATYGYYLGNPAEFHDSSDHHTFKKMLPRDERRFKAADLNGDLTATREEFTAFLHPEEFEHMKEIVVLETLEDIDKNGDGFVDQDEYIADMFSHEENGPEPDWVLSEREQFNEFRDLNKDGKLDKDEIRHWILPQDYDHAQAEARHLVYESDKNKDEKLTKEEILENWNMFVGSQATNYGEDLTKNHDEL
Gene Name RCN1 reticulocalbin 1, EF-hand calcium binding domain [ Homo sapiens ]
Official Symbol RCN1
Synonyms RCN1; reticulocalbin 1, EF-hand calcium binding domain; RCN; reticulocalbin-1; FLJ37041; PIG20; proliferation inducing gene 20; Rcal;
Gene ID 5954
mRNA Refseq NM_002901
Protein Refseq NP_002892
MIM 602735
Uniprot ID Q15293
Chromosome Location 11p13
Function calcium ion binding; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RCN1 Products

Required fields are marked with *

My Review for All RCN1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon