Recombinant Full Length Human Receptor Activity-Modifying Protein 1(Ramp1) Protein, His-Tagged
Cat.No. : | RFL4296HF |
Product Overview : | Recombinant Full Length Human Receptor activity-modifying protein 1(RAMP1) Protein (O60894) (27-148aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (27-148) |
Form : | Lyophilized powder |
AA Sequence : | CQEANYGALLRELCLTQFQVDMEAVGETLWCDWGRTIRSYRELADCTWHMAEKLGCFWPNAEVDRFFLAVHGRYFRSCPISGRAVRDPPGSILYPFIVVPITVTLLVTALVVWQSKRTEGIV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | RAMP1 |
Synonyms | RAMP1; Receptor activity-modifying protein 1; Calcitonin-receptor-like receptor activity-modifying protein 1; CRLR activity-modifying protein 1 |
UniProt ID | O60894 |
◆ Recombinant Proteins | ||
RFL4296HF | Recombinant Full Length Human Receptor Activity-Modifying Protein 1(Ramp1) Protein, His-Tagged | +Inquiry |
RAMP1-421H | Recombinant Human receptor (G protein-coupled) activity modifying protein 1, His-tagged | +Inquiry |
RAMP1-3965H | Recombinant Human RAMP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RAMP1-742H | Recombinant Human RAMP1 | +Inquiry |
RAMP1-4578R | Recombinant Rat RAMP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RAMP1-2537HCL | Recombinant Human RAMP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RAMP1 Products
Required fields are marked with *
My Review for All RAMP1 Products
Required fields are marked with *