Recombinant Full Length Human RFX8 Protein, GST-tagged
| Cat.No. : | RFX8-5925HF |
| Product Overview : | Human LOC731220 full-length ORF (BAD18461.1, 1 a.a. - 153 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 153 amino acids |
| Description : | RFX8 (RFX Family Member 8, Lacking RFX DNA Binding Domain) is a Protein Coding gene. GO annotations related to this gene include transcription factor activity, sequence-specific DNA binding and RNA polymerase II core promoter proximal region sequence-specific DNA binding. An important paralog of this gene is RFX6. |
| Molecular Mass : | 44.1 kDa |
| AA Sequence : | MYEIYVETCGQNTENQVNPATFGKLVRLVFPDLGTRWLGTRGSARYHYDGICIKKSSFFYAQYCCLIGEKRYHSGDAIAFEKSTNYNSIIQQEATCEDHSPMKTDPVGSPLSEFRRCPFLEQELAKKYSCNMMAFPADEYCNYCRDILRNVRN |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | RFX8 RFX family member 8, lacking RFX DNA binding domain [ Homo sapiens (human) ] |
| Official Symbol | RFX8 |
| Synonyms | RFX8; RFX family member 8, lacking RFX DNA binding domain; DNA-binding protein RFX8; RFX gene family member 8, lacking RFX DNA binding domain; regulatory factor X, 8 |
| Gene ID | 731220 |
| mRNA Refseq | NM_001145664 |
| Protein Refseq | NP_001139136 |
| UniProt ID | Q6ZV50 |
| ◆ Recombinant Proteins | ||
| RFX8-7554M | Recombinant Mouse RFX8 Protein, His (Fc)-Avi-tagged | +Inquiry |
| RFX8-4753H | Recombinant Human RFX8 Protein, GST-tagged | +Inquiry |
| RFX8-14119M | Recombinant Mouse RFX8 Protein | +Inquiry |
| RFX8-5925HF | Recombinant Full Length Human RFX8 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RFX8 Products
Required fields are marked with *
My Review for All RFX8 Products
Required fields are marked with *
