Recombinant Human RFX8 Protein, GST-tagged

Cat.No. : RFX8-4753H
Product Overview : Human LOC731220 full-length ORF (BAD18461.1, 1 a.a. - 153 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : RFX8 (RFX Family Member 8, Lacking RFX DNA Binding Domain) is a Protein Coding gene. GO annotations related to this gene include transcription factor activity, sequence-specific DNA binding and RNA polymerase II core promoter proximal region sequence-specific DNA binding. An important paralog of this gene is RFX6.
Molecular Mass : 44.1 kDa
AA Sequence : MYEIYVETCGQNTENQVNPATFGKLVRLVFPDLGTRWLGTRGSARYHYDGICIKKSSFFYAQYCCLIGEKRYHSGDAIAFEKSTNYNSIIQQEATCEDHSPMKTDPVGSPLSEFRRCPFLEQELAKKYSCNMMAFPADEYCNYCRDILRNVRN
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name RFX8 RFX family member 8, lacking RFX DNA binding domain [ Homo sapiens (human) ]
Official Symbol RFX8
Synonyms RFX8; RFX family member 8, lacking RFX DNA binding domain; DNA-binding protein RFX8; RFX gene family member 8, lacking RFX DNA binding domain; regulatory factor X, 8
Gene ID 731220
mRNA Refseq NM_001145664
Protein Refseq NP_001139136
UniProt ID Q6ZV50

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RFX8 Products

Required fields are marked with *

My Review for All RFX8 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon