Recombinant Human RFX8 Protein, GST-tagged

• Cat.No.: RFX8-4753H
• Product Overview: Human LOC731220 full-length ORF (BAD18461.1, 1 a.a. - 153 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: RFX8 (RFX Family Member 8, Lacking RFX DNA Binding Domain) is a Protein Coding gene. GO annotations related to this gene include transcription factor activity, sequence-specific DNA binding and RNA polymerase II core promoter proximal region sequence-specific DNA binding. An important paralog of this gene is RFX6.
• Molecular Mass: 44.1 kDa
• AA Sequence: MYEIYVETCGQNTENQVNPATFGKLVRLVFPDLGTRWLGTRGSARYHYDGICIKKSSFFYAQYCCLIGEKRYHSGDAIAFEKSTNYNSIIQQEATCEDHSPMKTDPVGSPLSEFRRCPFLEQELAKKYSCNMMAFPADEYCNYCRDILRNVRN
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: RFX8 RFX family member 8, lacking RFX DNA binding domain [ Homo sapiens (human) ]
• Official Symbol: RFX8
• Synonyms: RFX8; RFX family member 8, lacking RFX DNA binding domain; DNA-binding protein RFX8; RFX gene family member 8, lacking RFX DNA binding domain; regulatory factor X, 8
• Gene ID: 731220
• mRNA Refseq: NM_001145664
• Protein Refseq: NP_001139136
• UniProt ID: Q6ZV50