Recombinant Full Length Human RNF207 Protein, GST-tagged
Cat.No. : | RNF207-4942HF |
Product Overview : | Human FLJ46380 full-length ORF ( ENSP00000344316, 1 a.a. - 244 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 244 amino acids |
Description : | RNF207 (Ring Finger Protein 207) is a Protein Coding gene. GO annotations related to this gene include ion channel binding and Hsp70 protein binding. |
Molecular Mass : | 52.4 kDa |
AA Sequence : | MSGAIFGPLEGPSSLDAPSIHPLVCPLCHVQYERPCLLDCFHDFCAGCLRGRATDGRLTCPLCQHQTVLKGPSGLPPVDRLLQFLVDSSGDGVEAVRCANCDLECSEQAGAAGRVGEEQRVPGCTVPNACTCTQHVFRGRPGSGFSSTSLGHLGPKCEPHYTGGETEVQNKGLEPVSRQWQRLRPFDLGRAHWSPIQGGVVDLHRRGSPVCRPGPTLKGLCYPSGIEAATAQGRWGQHAVPSGL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | RNF207 ring finger protein 207 [ Homo sapiens ] |
Official Symbol | RNF207 |
Synonyms | RNF207; ring finger protein 207; C1orf188, chromosome 1 open reading frame 188; RING finger protein 207; FLJ32096; FLJ46380; OTTHUMG00000001089; C1orf188; FLJ46593; |
Gene ID | 388591 |
mRNA Refseq | NM_207396 |
Protein Refseq | NP_997279 |
MIM | 616923 |
UniProt ID | Q6ZRF8 |
◆ Recombinant Proteins | ||
RNF207-7673M | Recombinant Mouse RNF207 Protein, His (Fc)-Avi-tagged | +Inquiry |
RNF207-14331M | Recombinant Mouse RNF207 Protein | +Inquiry |
RNF207-4643H | Recombinant Human RNF207 protein, His&Myc-tagged | +Inquiry |
RNF207-4942HF | Recombinant Full Length Human RNF207 Protein, GST-tagged | +Inquiry |
RNF207-4355H | Recombinant Human RNF207 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RNF207 Products
Required fields are marked with *
My Review for All RNF207 Products
Required fields are marked with *
0
Inquiry Basket