Recombinant Full Length Human RPN1 Protein, C-Flag-tagged
Cat.No. : | RPN1-1186HFL |
Product Overview : | Recombinant Full Length Human RPN1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a type I integral membrane protein found only in the rough endoplasmic reticulum. The encoded protein is part of an N-oligosaccharyl transferase complex that links high mannose oligosaccharides to asparagine residues found in the Asn-X-Ser/Thr consensus motif of nascent polypeptide chains. This protein forms part of the regulatory subunit of the 26S proteasome and may mediate binding of ubiquitin-like domains to this proteasome. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 66.2 kDa |
AA Sequence : | MEAPAAGLFLLLLLGTWAPAPGSASSEAPPLINEDVKRTVDLSSHLAKVTAEVVLAHLGGGSTSRATSFL LALEPELEARLAHLGVQVKGEDEEENNLEVRETKIKGKSGRFFTVKLPVALDPGAKISVIVETVYTHVLH PYPTQITQSEKQFVVFEGNHYFYSPYPTKTQTMRVKLASRNVESYTKLGNPTRSEDLLDYGPFRDVPAYS QDTFKVHYENNSPFLTITSMTRVIEVSHWGNIAVEENVDLKHTGAVLKGPFSRYDYQRQPDSGISSIRSF KTILPAAAQDVYYRDEIGNVSTSHLLILDDSVEMEIRPRFPLFGGWKTHYIVGYNLPSYEYLYNLGDQYA LKMRFVDHVFDEQVIDSLTVKIILPEGAKNIEIDSPYEISRAPDELHYTYLDTFGRPVIVAYKKNLVEQH IQDIVVHYTFNKVLMLQEPLLVVAAFYILFFTVIIYVRLDFSITKDPAAEARMKVACITEQVLTLVNKRI GLYRHFDETVNRYKQSRDISTLNSGKKSLETEHKALTSEIALLQSRLKTEGSDLCDRVSEMQKLDAQVKE LVLKSAVEAERLVAGKLKKDTYIENEKLISGKRQELVTKIDHILDALTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transmembrane |
Protein Pathways : | Metabolic pathways, N-Glycan biosynthesis |
Full Length : | Full L. |
Gene Name | RPN1 ribophorin I [ Homo sapiens (human) ] |
Official Symbol | RPN1 |
Synonyms | OST1; RBPH1 |
Gene ID | 6184 |
mRNA Refseq | NM_002950.4 |
Protein Refseq | NP_002941.1 |
MIM | 180470 |
UniProt ID | P04843 |
◆ Recombinant Proteins | ||
RPN1-4000R | Recombinant Rhesus monkey RPN1 Protein, His-tagged | +Inquiry |
RPN1-8055H | Recombinant Human RPN1 protein, His-tagged | +Inquiry |
RPN1-3817R | Recombinant Rhesus Macaque RPN1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RPN1-4801R | Recombinant Rat RPN1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RPN1-1186HFL | Recombinant Full Length Human RPN1 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RPN1-2183HCL | Recombinant Human RPN1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RPN1 Products
Required fields are marked with *
My Review for All RPN1 Products
Required fields are marked with *
0
Inquiry Basket