Recombinant Full Length Human RTRAF Protein, C-Flag-tagged

Cat.No. : RTRAF-1955HFL
Product Overview : Recombinant Full Length Human RTRAF Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : Enables RNA binding activity; RNA polymerase II complex binding activity; and identical protein binding activity. Involved in negative regulation of protein kinase activity; positive regulation of transcription by RNA polymerase II; and tRNA splicing, via endonucleolytic cleavage and ligation. Located in microtubule cytoskeleton; nucleoplasm; and perinuclear region of cytoplasm. Part of tRNA-splicing ligase complex.
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass : 27.9 kDa
AA Sequence : MFRRKLTALDYHNPAGFNCKDETEFRNFIVWLEDQKIRHYKIEDRGNLRNIHSSDWPKFFEKYLRDVNCP FKIQDRQEAIDWLLGLAVRLEYGDNAEKYKDLVPDNSKTADNATKNAEPLINLDVNNPDFKAGVMALANL LQIQRHDDYLVMLKAIRILVQERLTQDAVAKANQTKEGLPVALDKHILGFDTGDAVLNEAAQILRLLHIE ELRELQTKINEAIVAVQAIIADPKTDHRLGKVGR myc-FLAG tag
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Full Length : Full L.
Gene Name RTRAF RNA transcription, translation and transport factor [ Homo sapiens (human) ]
Official Symbol RTRAF
Synonyms C14orf166, CGI-99, CGI99, CLE, CLE7, LCRP369, RLLM1, hCLE, hCLE1
Gene ID 51637
mRNA Refseq NM_016039.3
Protein Refseq NP_057123
MIM 610858
UniProt ID Q9Y224

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RTRAF Products

Required fields are marked with *

My Review for All RTRAF Products

Required fields are marked with *

0
cart-icon
0
compare icon