Recombinant Full Length Human RUVBL1 Protein, C-Flag-tagged
Cat.No. : | RUVBL1-929HFL |
Product Overview : | Recombinant Full Length Human RUVBL1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a protein that has both DNA-dependent ATPase and DNA helicase activities and belongs to the ATPases associated with diverse cellular activities (AAA+) protein family. The encoded protein associates with several multisubunit transcriptional complexes and with protein complexes involved in both ATP-dependent remodeling and histone modification. Alternate splicing results in multiple transcript variants. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 50 kDa |
AA Sequence : | MKIEEVKSTTKTQRIASHSHVKGLGLDESGLAKQAASGLVGQENAREACGVIVELIKSKKMAGRAVLLAG PPGTGKTALALAIAQELGSKVPFCPMVGSEVYSTEIKKTEVLMENFRRAIGLRIKETKEVYEGEVTELTP CETENPMGGYGKTISHVIIGLKTAKGTKQLKLDPSIFESLQKERVEAGDVIYIEANSGAVKRQGRCDTYA TEFDLEAEEYVPLPKGDVHKKKEIIQDVTLHDLDVANARPQGGQDILSMMGQLMKPKKTEITDKLRGEIN KVVNKYIDQGIAELVPGVLFVDEVHMLDIECFTYLHRALESSIAPIVIFASNRGNCVIRGTEDITSPHGI PLDLLDRVMIIRTMLYTPQEMKQIIKIRAQTEGINISEEALNHLGEIGTKTTLRYSVQLLTPANLLAKIN GKDSIEKEHVEEISELFYDAKSSAKILADQQDKYMKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Stem cell - Pluripotency, Transcription Factors |
Protein Pathways : | Wnt signaling pathway |
Full Length : | Full L. |
Gene Name | RUVBL1 RuvB like AAA ATPase 1 [ Homo sapiens (human) ] |
Official Symbol | RUVBL1 |
Synonyms | RVB1; TIH1; ECP54; TIP49; ECP-54; INO80H; NMP238; PONTIN; TIP49A; NMP 238; Pontin52 |
Gene ID | 8607 |
mRNA Refseq | NM_003707.3 |
Protein Refseq | NP_003698.1 |
MIM | 603449 |
UniProt ID | Q9Y265 |
◆ Recombinant Proteins | ||
RUVBL1-2475H | Recombinant Human RUVBL1, GST-tagged | +Inquiry |
RUVBL1-8637H | Recombinant Human RUVBL1 protein, His-tagged | +Inquiry |
RUVBL1-5203R | Recombinant Rat RUVBL1 Protein | +Inquiry |
RUVBL1-30681TH | Recombinant Human RUVBL1, His-tagged | +Inquiry |
RUVBL1-2009H | Recombinant Human RUVBL1 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RUVBL1-001HCL | Recombinant Human RUVBL1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RUVBL1 Products
Required fields are marked with *
My Review for All RUVBL1 Products
Required fields are marked with *
0
Inquiry Basket