Recombinant Full Length Human SCG3 Protein, C-Flag-tagged
Cat.No. : | SCG3-2107HFL |
Product Overview : | Recombinant Full Length Human SCG3 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a member of the chromogranin/secretogranin family of neuroendocrine secretory proteins. Granins may serve as precursors for biologically active peptides. Some granins have been shown to function as helper proteins in sorting and proteolytic processing of prohormones; however, the function of this protein is unknown. Two transcript variants encoding different isoforms have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 50.9 kDa |
AA Sequence : | MGFLGTGTWILVLVLPIQAFPKPGGSQDKSLHNRELSAERPLNEQIAEAEEDKIKKTYPPENKPGQSNYS FVDNLNLLKAITEKEKIEKERQSIRSSPLDNKLNVEDVDSTKNRKLIDDYDSTKSGLDHKFQDDPDGLHQ LDGTPLTAEDIVHKIAARIYEENDRAAFDKIVSKLLNLGLITESQAHTLEDEVAEVLQKLISKEANNYEE DPNKPTSWTENQAGKIPEKVTPMAAIQDGLAKGENDETVSNTLTLTNGLERRTKTYSEDNFEELQYFPNF YALLKSIDSEKEAKEKETLITIMKTLIDFVKMMVKYGTISPEEGVSYLENLDEMIALQTKNKLEKNATDN ISKLFPAPSEKSHEETDSTKEEAAKMEKEYGSLKDSTKDDNSNPGGKTDEPKGKTEAYLEAIRKNIEWLK KHDKKGNKEDYDLSKMRDFINKQADAYVEKGILDKEEAEAIKRIYSSL myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Secreted Protein |
Full Length : | Full L. |
Gene Name | SCG3 secretogranin III [ Homo sapiens (human) ] |
Official Symbol | SCG3 |
Synonyms | SGIII |
Gene ID | 29106 |
mRNA Refseq | NM_013243.4 |
Protein Refseq | NP_037375.2 |
MIM | 611796 |
UniProt ID | Q8WXD2 |
◆ Recombinant Proteins | ||
SCG3-5250R | Recombinant Rat SCG3 Protein | +Inquiry |
SCG3-354H | Recombinant Human SCG3 Protein, His-tagged | +Inquiry |
Scg3-1337R | Recombinant Rat Scg3 protein, His&Myc-tagged | +Inquiry |
SCG3-5831H | Recombinant Human SCG3 protein, His-tagged | +Inquiry |
SCG3-2526H | Recombinant Full Length Human SCG3, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SCG3-775HCL | Recombinant Human SCG3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SCG3 Products
Required fields are marked with *
My Review for All SCG3 Products
Required fields are marked with *
0
Inquiry Basket