Recombinant Full Length Human SCGB2A2 Protein, C-Flag-tagged

• Cat.No.: SCGB2A2-672HFL
• Product Overview: Recombinant Full Length Human SCGB2A2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: Flag
• Description: Predicted to be involved in androgen receptor signaling pathway. Predicted to be located in extracellular region. Predicted to be active in extracellular space.
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 10.3 kDa
• AA Sequence: MKLLMVLMLAALSQHCYAGSGCPLLENVISKTINPQVSKTEYKELLQEFIDDNATTNAIDELKECFLNQTDETLSNVEVFMQLIYDSSLCDLFTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Full Length: Full L.

Gene Information

• Gene Name: SCGB2A2 secretoglobin family 2A member 2 [ Homo sapiens (human) ]
• Official Symbol: SCGB2A2
• Synonyms: MGB1; UGB2; PSBP1
• Gene ID: 4250
• mRNA Refseq: NM_002411.4
• Protein Refseq: NP_002402.1
• MIM: 605562
• UniProt ID: Q13296