Recombinant Full Length Human SCGB2A2 Protein, C-Flag-tagged
| Cat.No. : | SCGB2A2-672HFL |
| Product Overview : | Recombinant Full Length Human SCGB2A2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Mammalian Cells |
| Tag : | Flag |
| Description : | Predicted to be involved in androgen receptor signaling pathway. Predicted to be located in extracellular region. Predicted to be active in extracellular space. |
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
| Molecular Mass : | 10.3 kDa |
| AA Sequence : | MKLLMVLMLAALSQHCYAGSGCPLLENVISKTINPQVSKTEYKELLQEFIDDNATTNAIDELKECFLNQTDETLSNVEVFMQLIYDSSLCDLFTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80 centigrade. |
| Concentration : | >50 ug/mL as determined by microplate BCA method. |
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Full Length : | Full L. |
| Gene Name | SCGB2A2 secretoglobin family 2A member 2 [ Homo sapiens (human) ] |
| Official Symbol | SCGB2A2 |
| Synonyms | MGB1; UGB2; PSBP1 |
| Gene ID | 4250 |
| mRNA Refseq | NM_002411.4 |
| Protein Refseq | NP_002402.1 |
| MIM | 605562 |
| UniProt ID | Q13296 |
| ◆ Recombinant Proteins | ||
| SCGB2A2-1304H | Recombinant Human Secretoglobin, Family 2A, Member 2, GST-tagged | +Inquiry |
| SCGB2A2-524H | Recombinant Human SCGB2A2 protein, Fc/His-tagged | +Inquiry |
| SCGB2A2-69H | Recombinant Human SCGB2A2 protein, MYC/DDK-tagged | +Inquiry |
| SCGB2A2-854H | Recombinant Human SCGB2A2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| SCGB2A2-3687H | Recombinant Human SCGB2A2, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SCGB2A2-2036HCL | Recombinant Human SCGB2A2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SCGB2A2 Products
Required fields are marked with *
My Review for All SCGB2A2 Products
Required fields are marked with *
