Recombinant Full Length Human SCN2B Protein
| Cat.No. : | SCN2B-457HF |
| Product Overview : | Recombinant full length Human Scn2b with N terminal proprietary tag; Predicted MWt 49.76 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Protein Length : | 215 amino acids |
| Description : | Sodium channel subunit beta-2 is a protein that in humans is encoded by the SCN2B gene. |
| Form : | Liquid |
| Molecular Mass : | 49.760kDa inclusive of tags |
| AA Sequence : | MHRDAWLPRPAFSLTGLSLFFSLVPPGRSMEVTVPATLNV LNGSDARLPCTFNSCYTVNHKQFSLNWTYQECNNCSEEMF LQFRMKIINLKLERFQDRVEFSGNPSKYDVSVMLRNVQPE DEGIYNCYIMNPPDRHRGHGKIHLQVLMEEPPERDSTVAV IVGASVGGFLAVVILVLMVVKCVRRKKEQKLSTDDLKTEE EGKTDGEGNPDDGAK |
| Purity : | Proprietary Purification |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
| Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
| Gene Name | SCN2B sodium channel, voltage-gated, type II, beta [ Homo sapiens ] |
| Official Symbol | SCN2B |
| Synonyms | SCN2B; sodium channel, voltage-gated, type II, beta; sodium channel, voltage gated, type II, beta polypeptide; sodium channel subunit beta-2 |
| Gene ID | 6327 |
| mRNA Refseq | NM_004588 |
| Protein Refseq | NP_004579 |
| MIM | 601327 |
| UniProt ID | O60939 |
| ◆ Recombinant Proteins | ||
| SCN2B-310H | Recombinant Human SCN2B, His tagged | +Inquiry |
| SCN2B-31351TH | Recombinant Human SCN2B | +Inquiry |
| SCN2B-2536H | Recombinant Human SCN2B, GST-tagged | +Inquiry |
| SCN2B-4922R | Recombinant Rat SCN2B Protein, His (Fc)-Avi-tagged | +Inquiry |
| SCN2B-457HF | Recombinant Full Length Human SCN2B Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SCN2B-975HCL | Recombinant Human SCN2B cell lysate | +Inquiry |
| SCN2B-1280HCL | Recombinant Human SCN2B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SCN2B Products
Required fields are marked with *
My Review for All SCN2B Products
Required fields are marked with *
