Recombinant Full Length Human SCN2B Protein
Cat.No. : | SCN2B-457HF |
Product Overview : | Recombinant full length Human Scn2b with N terminal proprietary tag; Predicted MWt 49.76 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
Description : | Sodium channel subunit beta-2 is a protein that in humans is encoded by the SCN2B gene. |
Source : | In Vitro Cell Free System |
Species : | Human |
Form : | Liquid |
Molecular Mass : | 49.760kDa inclusive of tags |
Protein Length : | 215 amino acids |
AA Sequence : | MHRDAWLPRPAFSLTGLSLFFSLVPPGRSMEVTVPATLNV LNGSDARLPCTFNSCYTVNHKQFSLNWTYQECNNCSEEMF LQFRMKIINLKLERFQDRVEFSGNPSKYDVSVMLRNVQPE DEGIYNCYIMNPPDRHRGHGKIHLQVLMEEPPERDSTVAV IVGASVGGFLAVVILVLMVVKCVRRKKEQKLSTDDLKTEE EGKTDGEGNPDDGAK |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name : | SCN2B sodium channel, voltage-gated, type II, beta [ Homo sapiens ] |
Official Symbol : | SCN2B |
Synonyms : | SCN2B; sodium channel, voltage-gated, type II, beta; sodium channel, voltage gated, type II, beta polypeptide; sodium channel subunit beta-2 |
Gene ID : | 6327 |
mRNA Refseq : | NM_004588 |
Protein Refseq : | NP_004579 |
MIM : | 601327 |
UniProt ID : | O60939 |
Products Types
◆ Recombinant Protein | ||
SCN2B-3917R | Recombinant Rhesus Macaque SCN2B Protein, His (Fc)-Avi-tagged | +Inquiry |
SCN2B-4922R | Recombinant Rat SCN2B Protein, His (Fc)-Avi-tagged | +Inquiry |
SCN2B-5263R | Recombinant Rat SCN2B Protein | +Inquiry |
SCN2B-310H | Recombinant Human SCN2B, His tagged | +Inquiry |
SCN2B-2536H | Recombinant Human SCN2B, GST-tagged | +Inquiry |
◆ Lysates | ||
SCN2B-975HCL | Recombinant Human SCN2B cell lysate | +Inquiry |
SCN2B-1280HCL | Recombinant Human SCN2B cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket