Recombinant Full Length Human SECTM1 Protein
Cat.No. : | SECTM1-460HF |
Product Overview : | Recombinant full length protein Human SECTM1 containing an N-terminal proprietary tag; Predicted MW 50.31 kDa |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 220 amino acids |
Description : | This gene encodes a transmembrane and secreted protein with characteristics of a type 1a transmembrane protein. It is found in a perinuclear Golgi-like pattern and thought to be involved in hematopoietic and/or immune system processes. |
Form : | Liquid |
Molecular Mass : | 50.310kDa inclusive of tags |
AA Sequence : | QNEGWDSPICTEGVVSVSWGENTVMSCNISNAFSHVNIKL RAHGQESAIFNEVAPGYFSRDGWQLQVQGGVAQLVIKGAR DSHAGLYMWHLVGHQRNNRQVTLEVSGAEPQSAPDTGFWP VPAVVTAVFILLVALVMFAWYRCRCSQQRREKKFFLLEPQ MKFAALRAGAQQGLSRASAELWTPDSEPTPRPLALVFKPS PLGALELLSPQPLFPYAADP |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | SECTM1 secreted and transmembrane 1 [ Homo sapiens ] |
Official Symbol | SECTM1 |
Synonyms | SECTM1; secreted and transmembrane 1; secreted and transmembrane protein 1; K12; K12 protein; type 1a transmembrane protein |
Gene ID | 6398 |
mRNA Refseq | NM_003004 |
Protein Refseq | NP_002995 |
MIM | 602602 |
UniProt ID | Q8WVN6 |
◆ Recombinant Proteins | ||
SECTM1-31348TH | Recombinant Human SECTM1 | +Inquiry |
SECTM1-6258H | Recombinant Human SECTM1 Protein (Gln29-Gly145), C-His tagged | +Inquiry |
SECTM1-2571H | Recombinant Human SECTM1, His-tagged | +Inquiry |
SECTM1-3967H | Recombinant Human SECTM1 protein, His-tagged | +Inquiry |
SECTM1-438H | Recombinant Human SECTM1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SECTM1-1946HCL | Recombinant Human SECTM1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SECTM1 Products
Required fields are marked with *
My Review for All SECTM1 Products
Required fields are marked with *