Recombinant Full Length Human SECTM1 Protein
Cat.No. : | SECTM1-460HF |
Product Overview : | Recombinant full length protein Human SECTM1 containing an N-terminal proprietary tag; Predicted MW 50.31 kDa |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes a transmembrane and secreted protein with characteristics of a type 1a transmembrane protein. It is found in a perinuclear Golgi-like pattern and thought to be involved in hematopoietic and/or immune system processes. |
Source : | In Vitro Cell Free System |
Species : | Human |
Form : | Liquid |
Molecular Mass : | 50.310kDa inclusive of tags |
Protein Length : | 220 amino acids |
AA Sequence : | QNEGWDSPICTEGVVSVSWGENTVMSCNISNAFSHVNIKL RAHGQESAIFNEVAPGYFSRDGWQLQVQGGVAQLVIKGAR DSHAGLYMWHLVGHQRNNRQVTLEVSGAEPQSAPDTGFWP VPAVVTAVFILLVALVMFAWYRCRCSQQRREKKFFLLEPQ MKFAALRAGAQQGLSRASAELWTPDSEPTPRPLALVFKPS PLGALELLSPQPLFPYAADP |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name : | SECTM1 secreted and transmembrane 1 [ Homo sapiens ] |
Official Symbol : | SECTM1 |
Synonyms : | SECTM1; secreted and transmembrane 1; secreted and transmembrane protein 1; K12; K12 protein; type 1a transmembrane protein |
Gene ID : | 6398 |
mRNA Refseq : | NM_003004 |
Protein Refseq : | NP_002995 |
MIM : | 602602 |
UniProt ID : | Q8WVN6 |
Products Types
◆ Recombinant Protein | ||
SECTM1-438H | Recombinant Human SECTM1 Protein, His-tagged | +Inquiry |
SECTM1-4550H | Recombinant Human SECTM1 protein, hFc-tagged | +Inquiry |
SECTM1-1947H | Recombinant Human SECTM1 protein, His & GST-tagged | +Inquiry |
SECTM1-1273H | Active Recombinant Human SECTM1 protein, hFc&His-tagged | +Inquiry |
SECTM1-6258H | Recombinant Human SECTM1 Protein (Gln29-Gly145), C-His tagged | +Inquiry |
◆ Lysates | ||
SECTM1-1946HCL | Recombinant Human SECTM1 cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket