Recombinant Full Length Human SECTM1 Protein
| Cat.No. : | SECTM1-460HF |
| Product Overview : | Recombinant full length protein Human SECTM1 containing an N-terminal proprietary tag; Predicted MW 50.31 kDa |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Protein Length : | 220 amino acids |
| Description : | This gene encodes a transmembrane and secreted protein with characteristics of a type 1a transmembrane protein. It is found in a perinuclear Golgi-like pattern and thought to be involved in hematopoietic and/or immune system processes. |
| Form : | Liquid |
| Molecular Mass : | 50.310kDa inclusive of tags |
| AA Sequence : | QNEGWDSPICTEGVVSVSWGENTVMSCNISNAFSHVNIKL RAHGQESAIFNEVAPGYFSRDGWQLQVQGGVAQLVIKGAR DSHAGLYMWHLVGHQRNNRQVTLEVSGAEPQSAPDTGFWP VPAVVTAVFILLVALVMFAWYRCRCSQQRREKKFFLLEPQ MKFAALRAGAQQGLSRASAELWTPDSEPTPRPLALVFKPS PLGALELLSPQPLFPYAADP |
| Purity : | Proprietary Purification |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
| Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
| Gene Name | SECTM1 secreted and transmembrane 1 [ Homo sapiens ] |
| Official Symbol | SECTM1 |
| Synonyms | SECTM1; secreted and transmembrane 1; secreted and transmembrane protein 1; K12; K12 protein; type 1a transmembrane protein |
| Gene ID | 6398 |
| mRNA Refseq | NM_003004 |
| Protein Refseq | NP_002995 |
| MIM | 602602 |
| UniProt ID | Q8WVN6 |
| ◆ Recombinant Proteins | ||
| SECTM1-438H | Recombinant Human SECTM1 Protein, His-tagged | +Inquiry |
| SECTM1-4550H | Recombinant Human SECTM1 protein, hFc-tagged | +Inquiry |
| SECTM1-3967H | Recombinant Human SECTM1 protein, His-tagged | +Inquiry |
| SECTM1-2571H | Recombinant Human SECTM1, His-tagged | +Inquiry |
| SECTM1-1273H | Active Recombinant Human SECTM1 protein, hFc&His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SECTM1-1946HCL | Recombinant Human SECTM1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SECTM1 Products
Required fields are marked with *
My Review for All SECTM1 Products
Required fields are marked with *
