Recombinant Full Length Human SEMA7A Protein, C-Flag-tagged
Cat.No. : | SEMA7A-110HFL |
Product Overview : | Recombinant Full Length Human SEMA7A Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the semaphorin family of proteins. The encoded preproprotein is proteolytically processed to generate the mature glycosylphosphatidylinositol (GPI)-anchored membrane glycoprotein. The encoded protein is found on activated lymphocytes and erythrocytes and may be involved in immunomodulatory and neuronal processes. The encoded protein carries the John Milton Hagen (JMH) blood group antigens. Mutations in this gene may be associated with reduced bone mineral density (BMD). Alternative splicing results in multiple transcript variants, at least one of which encodes an isoform that is proteolytically processed. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 70.3 kDa |
AA Sequence : | MTPPPPGRAAPSAPRARVPGPPARLGLPLRLRLLLLLWAAAASAQGHLRSGPRIFAVWKGHVGQDRVDFG QTEPHTVLFHEPGSSSVWVGGRGKVYLFDFPEGKNASVRTVNIGSTKGSCLDKRDCENYITLLERRSEGL LACGTNARHPSCWNLVNGTVVPLGEMRGYAPFSPDENSLVLFEGDEVYSTIRKQEYNGKIPRFRRIRGES ELYTSDTVMQNPQFIKATIVHQDQAYDDKIYYFFREDNPDKNPEAPLNVSRVAQLCRGDQGGESSLSVSK WNTFLKAMLVCSDAATNKNFNRLQDVFLLPDPSGQWRDTRVYGVFSNPWNYSAVCVYSLGDIDKVFRTSS LKGYHSSLPNPRPGKCLPDQQPIPTETFQVADRHPEVAQRVEPMGPLKTPLFHSKYHYQKVAVHRMQASH GETFHVLYLTTDRGTIHKVVEPGEQEHSFAFNIMEIQPFRRAAAIQTMSLDAERRKLYVSSQWEVSQVPL DLCEVYGGGCHGCLMSRDPYCGWDQGRCISIYSSERSVLQSINPAEPHKECPNPKPDKAPLQKVSLAPNS RYYLSCPMESRHATYSWRHKENVEQSCEPGHQSPNCILFIENLTAQQYGHYFCEAQEGSYFREAQHWQLL PEDGIMAEHLLGHACALAASLWLGVLPTLTLGLLVHTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Pathways : | Axon guidance |
Full Length : | Full L. |
Gene Name | SEMA7A semaphorin 7A (John Milton Hagen blood group) [ Homo sapiens (human) ] |
Official Symbol | SEMA7A |
Synonyms | JMH; CD108; SEMAL; CDw108; PFIC11; SEMAK1; H-Sema-L; H-SEMA-K1 |
Gene ID | 8482 |
mRNA Refseq | NM_003612.5 |
Protein Refseq | NP_003603.1 |
MIM | 607961 |
UniProt ID | O75326 |
◆ Recombinant Proteins | ||
Sema7a-191M | Active Recombinant Mouse Sema7a protein, Fc-tagged | +Inquiry |
Sema7a-6974M | Recombinant Mouse Sema7a protein, His-tagged | +Inquiry |
SEMA7A-3753H | Recombinant Human SEMA7A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SEMA7A-110HFL | Recombinant Full Length Human SEMA7A Protein, C-Flag-tagged | +Inquiry |
SEMA7A-1537R | Recombinant Rhesus Monkey SEMA7A Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SEMA7A-1978HCL | Recombinant Human SEMA7A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SEMA7A Products
Required fields are marked with *
My Review for All SEMA7A Products
Required fields are marked with *
0
Inquiry Basket