Recombinant Full Length Human SERPINA4 Protein, C-Flag-tagged
Cat.No. : | SERPINA4-2178HFL |
Product Overview : | Recombinant Full Length Human SERPINA4 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Predicted to enable serine-type endopeptidase inhibitor activity. Predicted to be involved in negative regulation of endopeptidase activity. Located in extracellular exosome. Biomarker of diabetic retinopathy. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 48.4 kDa |
AA Sequence : | MHLIDYLLLLLVGLLALSHGQLHVEHDGESCSNSSHQQILETGEGSPSLKIAPANADFAFRFYYLIASET PGKNIFFSPLSISAAYAMLSLGACSHSRSQILEGLGFNLTELSESDVHRGFQHLLHTLNLPGHGLETRVG SALFLSHNLKFLAKFLNDTMAVYEAKLFHTNFYDTVGTIQLINDHVKKETRGKIVDLVSELKKDVLMVLV NYIYFKALWEKPFISSRTTPKDFYVDENTTVRVPMMLQDQEHHWYLHDRYLPCSVLRMDYKGDATVFFIL PNQGKMREIEEVLTPEMLMRWNNLLRKRNFYKKLELHLPKFSISGSYVLDQILPRLGFTDLFSKWADLSG ITKQQKLEASKSFHKATLDVDEAGTEAAAATSFAIKFFSAQTNRHILRFNRPFLVVIFSTSTQSVLFLGK VVDPTKP SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Secreted Protein |
Full Length : | Full L. |
Gene Name | SERPINA4 serpin family A member 4 [ Homo sapiens (human) ] |
Official Symbol | SERPINA4 |
Synonyms | KAL; KST; PI4; KLST; PI-4; kallistatin |
Gene ID | 5267 |
mRNA Refseq | NM_006215.4 |
Protein Refseq | NP_006206.2 |
MIM | 147935 |
UniProt ID | P29622 |
◆ Recombinant Proteins | ||
SERPINA4-2178HFL | Recombinant Full Length Human SERPINA4 Protein, C-Flag-tagged | +Inquiry |
SERPINA4-185H | Active Recombinant Human SERPINA4, His-tagged | +Inquiry |
SERPINA4-860H | Recombinant Human SERPINA4 Protein, MYC/DDK-tagged | +Inquiry |
SERPINA4-5911H | Recombinant Human SERPINA4 Protein (Gln21-Pro427), C-His tagged | +Inquiry |
SERPINA4-5800H | Recombinant Human SERPINA4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SERPINA4 Products
Required fields are marked with *
My Review for All SERPINA4 Products
Required fields are marked with *
0
Inquiry Basket