Recombinant Full Length Human SERPINB4 Protein, C-Flag-tagged
Cat.No. : | SERPINB4-2198HFL |
Product Overview : | Recombinant Full Length Human SERPINB4 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a member of the serpin family of serine protease inhibitors. The encoded protein is highly expressed in many tumor cells and can inactivate granzyme M, an enzyme that kills tumor cells. This protein, along with serpin B3, can be processed into smaller fragments that aggregate to form an autoantigen in psoriasis, probably by causing chronic inflammation. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 44.7 kDa |
AA Sequence : | MNSLSEANTKFMFDLFQQFRKSKENNIFYSPISITSALGMVLLGAKDNTAQQISKVLHFDQVTENTTEKA ATYHVDRSGNVHHQFQKLLTEFNKSTDAYELKIANKLFGEKTYQFLQEYLDAIKKFYQTSVESTDFANAP EESRKKINSWVESQTNEKIKNLFPDGTIGNDTTLVLVNAIYFKGQWENKFKKENTKEEKFWPNKNTYKSV QMMRQYNSFNFALLEDVQAKVLEIPYKGKDLSMIVLLPNEIDGLQKLEEKLTAEKLMEWTSLQNMRETCV DLHLPRFKMEESYDLKDTLRTMGMVNIFNGDADLSGMTWSHGLSVSKVLHKAFVEVTEEGVEAAAATAVV VVELSSPSTNEEFCCNHPFLFFIRQNKTNSILFYGRFSSP myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Secreted Protein |
Full Length : | Full L. |
Gene Name | SERPINB4 serpin family B member 4 [ Homo sapiens (human) ] |
Official Symbol | SERPINB4 |
Synonyms | PI11; SCCA1; SCCA2; LEUPIN; SCCA-2 |
Gene ID | 6318 |
mRNA Refseq | NM_002974.4 |
Protein Refseq | NP_002965.1 |
MIM | 600518 |
UniProt ID | P48594 |
◆ Recombinant Proteins | ||
SERPINB4-2594H | Recombinant Human SERPINB4, GST-tagged | +Inquiry |
SERPINB4-3482H | Recombinant Human SERPINB4 protein, His-SUMO-tagged | +Inquiry |
SERPINB4-6240H | Recombinant Human SERPINB4 Protein (Ser320-Pro390), N-GST tagged | +Inquiry |
SERPINB4-2198HFL | Recombinant Full Length Human SERPINB4 Protein, C-Flag-tagged | +Inquiry |
SERPINB4-1763H | Recombinant Human SERPINB4 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SERPINB4-523HCL | Recombinant Human SERPINB4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SERPINB4 Products
Required fields are marked with *
My Review for All SERPINB4 Products
Required fields are marked with *
0
Inquiry Basket