Recombinant Full Length Human SGCG Protein, C-Flag-tagged
Cat.No. : | SGCG-1905HFL |
Product Overview : | Recombinant Full Length Human SGCG Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes gamma-sarcoglycan, one of several sarcolemmal transmembrane glycoproteins that interact with dystrophin. The dystrophin-glycoprotein complex (DGC) spans the sarcolemma and is comprised of dystrophin, syntrophin, alpha- and beta-dystroglycans and sarcoglycans. The DGC provides a structural link between the subsarcolemmal cytoskeleton and the extracellular matrix of muscle cells. Defects in the encoded protein can lead to early onset autosomal recessive muscular dystrophy, in particular limb-girdle muscular dystrophy, type 2C (LGMD2C). |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 32.2 kDa |
AA Sequence : | MVREQYTTATEGICIERPENQYVYKIGIYGWRKRCLYLFVLLLLIILVVNLALTIWILKVMWFSPAGMGH LCVTKDGLRLEGESEFLFPLYAKEIHSRVDSSLLLQSTQNVTVNARNSEGEVTGRLKVGPKMVEVQNQQF QINSNDGKPLFTVDEKEVVVGTDKLRVTGPEGALFEHSVETPLVRADPFQDLRLESPTRSLSMDAPRGVH IQAHAGKIEALSQMDILFHSSDGMLVLDAETVCLPKLVQGTWGPSGSSQSLYEICVCPDGKLYLSVAGVS TTCQEHSHICL myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transmembrane |
Protein Pathways : | Arrhythmogenic right ventricular cardiomyopathy (ARVC), Dilated cardiomyopathy, Hypertrophic cardiomyopathy (HCM), Viral myocarditis |
Full Length : | Full L. |
Gene Name | SGCG sarcoglycan gamma [ Homo sapiens (human) ] |
Official Symbol | SGCG |
Synonyms | A4; MAM; DMDA; SCG3; 35DAG; DAGA4; DMDA1; LGMD2C; LGMDR5; SCARMD2; gamma-SG |
Gene ID | 6445 |
mRNA Refseq | NM_000231.3 |
Protein Refseq | NP_000222.2 |
MIM | 608896 |
UniProt ID | Q13326 |
◆ Recombinant Proteins | ||
SGCG-8099M | Recombinant Mouse SGCG Protein, His (Fc)-Avi-tagged | +Inquiry |
SGCG-15032M | Recombinant Mouse SGCG Protein | +Inquiry |
SGCG-1996H | Recombinant Human SGCG Protein, His (Fc)-Avi-tagged | +Inquiry |
SGCG-359H | Recombinant Human SGCG Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
SGCG-28970TH | Recombinant Human SGCG | +Inquiry |
◆ Cell & Tissue Lysates | ||
SGCG-1887HCL | Recombinant Human SGCG 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SGCG Products
Required fields are marked with *
My Review for All SGCG Products
Required fields are marked with *
0
Inquiry Basket