Recombinant Full Length Human SH3BGRL Protein

• Cat.No.: SH3BGRL-470HF
• Product Overview: Recombinant full length Human SH3BGRL with N-terminal proprietary tag. Predicted MW 38.65 kDa.

Specification

• Description: SH3 domain-binding glutamic acid-rich-like protein is a protein that in humans is encoded by the SH3BGRL gene.
• Source: In Vitro Cell Free System
• Species: Human
• Form: Liquid
• Molecular Mass: 38.650kDa inclusive of tags
• Protein Length: 114 amino acids
• AA Sequence: MVIRVYIASSSGSTAIKKKQQDVLGFLEANKIGFEEKDIA ANEENRKWMRENVPENSRPATGYPLPPQIFNESQYRGDYD AFFEARENNAVYAFLGLTAPPGSKEAEVQAKQQA
• Purity: Proprietary Purification
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
• Storage Buffer: pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.

Gene Information

• Gene Name: SH3BGRL SH3 domain binding glutamic acid-rich protein like [ Homo sapiens ]
• Official Symbol: SH3BGRL
• Synonyms: SH3BGRL; SH3 domain binding glutamic acid-rich protein like; SH3 domain-binding glutamic acid-rich-like protein; MGC117402
• Gene ID: 6451
• mRNA Refseq: NM_003022
• Protein Refseq: NP_003013
• MIM: 300190
• UniProt ID: O75368