Recombinant Full Length Human SLC25A3 Protein
Cat.No. : | SLC25A3-477HF |
Product Overview : | Recombinant full length Human SLC25A3 with N terminal proprietary tag; Predicted MWt 65.45 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 361 amino acids |
Description : | The protein encoded by this gene catalyzes the transport of phosphate into the mitochondrial matrix, either by proton cotransport or in exchange for hydroxyl ions. The protein contains three related segments arranged in tandem which are related to those found in other characterized members of the mitochondrial carrier family. Both the N-terminal and C-terminal regions of this protein protrude toward the cytosol. Multiple alternatively spliced transcript variants have been isolated. |
Form : | Liquid |
Molecular Mass : | 65.450kDa inclusive of tags |
AA Sequence : | MFSSVAHLARANPFNTPHLQLVHDGLGDLRSSSPGPTGQP RRPRNLAAAAVEEYSCEFGSAKYYALCGFGGVLSCGLTHT AVVPLDLVKCRMQVDPQKYKGIFNGFSVTLKEDGVRGLAK GWAPTFLGYSMQGLCKFGFYEVFKVLYSNMLGEENTYLWR TSLYLAASASAEFFADIALAPMEAAKVRIQTQPGYANTLR DAAPKMYKEEGLKAFYKGVAPLWMRQIPYTMMKFACCERT VEALYKFVVPKPRSECSKPEQLVVTFVAGYIAGVFCAIVS HPADSVVSVLNKEKGSSASLVLKRLGFKGVWKGLFARIIM IGTLTALQWFIYDSVKVYFRLPRPPPPEMPESLKKKLGLT Q |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | SLC25A3 solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 3 [ Homo sapiens ] |
Official Symbol | SLC25A3 |
Synonyms | SLC25A3; solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 3; PHC; phosphate carrier protein, mitochondrial |
Gene ID | 5250 |
mRNA Refseq | NM_002635 |
Protein Refseq | NP_002626 |
MIM | 600370 |
UniProt ID | Q00325 |
◆ Recombinant Proteins | ||
SLC25A3-2723H | Recombinant Human SLC25A3, His-tagged | +Inquiry |
RFL18878BF | Recombinant Full Length Bovine Phosphate Carrier Protein, Mitochondrial(Slc25A3) Protein, His-Tagged | +Inquiry |
Slc25a3-5913M | Recombinant Mouse Slc25a3 Protein, Myc/DDK-tagged | +Inquiry |
SLC25A3-15316M | Recombinant Mouse SLC25A3 Protein | +Inquiry |
SLC25A3-4068R | Recombinant Rhesus Macaque SLC25A3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC25A3-1771HCL | Recombinant Human SLC25A3 293 Cell Lysate | +Inquiry |
SLC25A3-1770HCL | Recombinant Human SLC25A3 293 Cell Lysate | +Inquiry |
SLC25A3-1772HCL | Recombinant Human SLC25A3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC25A3 Products
Required fields are marked with *
My Review for All SLC25A3 Products
Required fields are marked with *
0
Inquiry Basket