Recombinant Full Length Human SLC25A3 Protein
Cat.No. : | SLC25A3-477HF |
Product Overview : | Recombinant full length Human SLC25A3 with N terminal proprietary tag; Predicted MWt 65.45 kDa. |
- Specification
- Gene Information
- Related Products
Description : | The protein encoded by this gene catalyzes the transport of phosphate into the mitochondrial matrix, either by proton cotransport or in exchange for hydroxyl ions. The protein contains three related segments arranged in tandem which are related to those found in other characterized members of the mitochondrial carrier family. Both the N-terminal and C-terminal regions of this protein protrude toward the cytosol. Multiple alternatively spliced transcript variants have been isolated. |
Source : | In Vitro Cell Free System |
Species : | Human |
Form : | Liquid |
Molecular Mass : | 65.450kDa inclusive of tags |
Protein Length : | 361 amino acids |
AA Sequence : | MFSSVAHLARANPFNTPHLQLVHDGLGDLRSSSPGPTGQP RRPRNLAAAAVEEYSCEFGSAKYYALCGFGGVLSCGLTHT AVVPLDLVKCRMQVDPQKYKGIFNGFSVTLKEDGVRGLAK GWAPTFLGYSMQGLCKFGFYEVFKVLYSNMLGEENTYLWR TSLYLAASASAEFFADIALAPMEAAKVRIQTQPGYANTLR DAAPKMYKEEGLKAFYKGVAPLWMRQIPYTMMKFACCERT VEALYKFVVPKPRSECSKPEQLVVTFVAGYIAGVFCAIVS HPADSVVSVLNKEKGSSASLVLKRLGFKGVWKGLFARIIM IGTLTALQWFIYDSVKVYFRLPRPPPPEMPESLKKKLGLT Q |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name : | SLC25A3 solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 3 [ Homo sapiens ] |
Official Symbol : | SLC25A3 |
Synonyms : | SLC25A3; solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 3; PHC; phosphate carrier protein, mitochondrial |
Gene ID : | 5250 |
mRNA Refseq : | NM_002635 |
Protein Refseq : | NP_002626 |
MIM : | 600370 |
UniProt ID : | Q00325 |
Products Types
◆ Recombinant Protein | ||
Slc25a3-5913M | Recombinant Mouse Slc25a3 Protein, Myc/DDK-tagged | +Inquiry |
SLC25A3-8283M | Recombinant Mouse SLC25A3 Protein, His (Fc)-Avi-tagged | +Inquiry |
SLC25A3-4068R | Recombinant Rhesus Macaque SLC25A3 Protein, His (Fc)-Avi-tagged | +Inquiry |
SLC25A3-1383C | Recombinant Chicken SLC25A3 | +Inquiry |
SLC25A3-15316M | Recombinant Mouse SLC25A3 Protein | +Inquiry |
◆ Lysates | ||
SLC25A3-1771HCL | Recombinant Human SLC25A3 293 Cell Lysate | +Inquiry |
SLC25A3-1772HCL | Recombinant Human SLC25A3 293 Cell Lysate | +Inquiry |
SLC25A3-1770HCL | Recombinant Human SLC25A3 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket