Recombinant Full Length Human SOX1 Protein, C-Flag-tagged
Cat.No. : | SOX1-1537HFL |
Product Overview : | Recombinant Full Length Human SOX1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This intronless gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional activator after forming a protein complex with other proteins. In mice, a similar protein regulates the gamma-crystallin genes and is essential for lens development. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 38.8 kDa |
AA Sequence : | MYSMMMETDLHSPGGAQAPTNLSGPAGAGGGGGGGGGGGGGGGAKANQDRVKRPMNAFMVWSRGQRRKMA QENPKMHNSEISKRLGAEWKVMSEAEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKTLLKKDKYSLAGG LLAAGAGGGGAAVAMGVGVGVGAAAVGQRLESPGGAAGGGYAHVNGWANGAYPGSVAAAAAAAAMMQEAQ LAYGQHPGAGGAHPHAHPAHPHPHHPHAHPHNPQPMHRYDMGALQYSPISNSQGYMSASPSGYGGLPYGA AAAAAAAAGGAHQNSAVAAAAAAAAASSGALGALGSLVKSEPSGSPPAPAHSRAPCPGDLREMISMYLPA GEGGDPAAAAAAAAQSRLHSLPQHYQGAGAGVNGTVPLTHISGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Adult stem cells, ES Cell Differentiation/IPS, Induced pluripotent stem cells, Transmembrane |
Full Length : | Full L. |
Gene Name | SOX1 SRY-box transcription factor 1 [ Homo sapiens (human) ] |
Official Symbol | SOX1 |
Synonyms | SRY (sex determining region Y)-box 1; SRY-related HMG-box gene 1 |
Gene ID | 6656 |
mRNA Refseq | NM_005986.3 |
Protein Refseq | NP_005977.2 |
MIM | 602148 |
UniProt ID | O00570 |
◆ Recombinant Proteins | ||
SOX1-1537HFL | Recombinant Full Length Human SOX1 Protein, C-Flag-tagged | +Inquiry |
SOX1-4322C | Recombinant Chicken SOX1 protein, His&Myc-tagged | +Inquiry |
sox1-5944S | Recombinant Silurana tropicalis sox1 protein, His&His-tagged | +Inquiry |
SOX1-2072H | Recombinant Human SOX1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Sox1-6048M | Recombinant Mouse Sox1 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SOX1-1566HCL | Recombinant Human SOX1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SOX1 Products
Required fields are marked with *
My Review for All SOX1 Products
Required fields are marked with *
0
Inquiry Basket