Recombinant Full Length Human SPDEF Protein, GST tagged

• Cat.No.: SPDEF-32H
• Product Overview: Human SPDEF full-length ORF (AAH21299, 1 a.a. - 335 a.a.) recombinant protein with GST-tag at N-terminal was expressed in Wheat Germ (in vitro).

Specification

• Species: Human
• Source: Wheat Germ (in vitro)
• Tag: GST
• Protein Length: 1-335 aa
• Description: PDEF is an ETS transcription factor expressed in prostate epithelial cells. It acts as an androgen-independent transactivator of PSA expression.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 62.59 kDa
• AASequence: MGSASPGLSSVSPSHLLLPPDTVSRTGLEKAAAGAVGLERRDWSPSPPATPEQGLSAFYLSYFDMLYPEDSSWAAKAPGASSREEPPEEPEQCPVIDSQAPAGSLDLVPGGLTLEEHSLEQVQSMVVGEVLKDIETACKLLNITADPMDWSPSNVQKWLLWTEHQYRLPPMGKAFQELAGKELCAMSEEQFRQRSPLGGDVLHAHLDIWKSAAWMKERTSPGAIHYCASTSEESWTDSEVDSSCSGQPIHLWQFLKELLLKPHSYGRFIRWLNKEKGIFKIEDSAQVARLWGIRKNRPAMNYDKLSRSIRQYYKKGIIRKPDISQRLVYQFVHPI
• Applications: Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: SPDEF SAM pointed domain containing ets transcription factor [ Homo sapiens (human) ]
• Official Symbol: SPDEF
• Synonyms: SPDEF; SAM pointed domain containing ets transcription factor; SAM pointed domain-containing Ets transcription factor; bA375E1.3; PDEF; prostate-specific Ets; prostate-derived Ets factor; prostate epithelium-specific Ets transcription factor; RP11-375E1__A.3
• Gene ID: 25803
• mRNA Refseq: NM_001252294
• Protein Refseq: NP_001239223
• MIM: 608144
• UniProt ID: O95238