Recombinant Full Length Human SPINK7 Protein, GST-tagged
| Cat.No. : | SPINK7-4746HF |
| Product Overview : | Human ECG2 full-length ORF ( NP_115955.1, 1 a.a. - 85 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 85 amino acids |
| Description : | SPINK7 (Serine Peptidase Inhibitor, Kazal Type 7 (Putative)) is a Protein Coding gene. Diseases associated with SPINK7 include Esophageal Cancer. GO annotations related to this gene include serine-type endopeptidase inhibitor activity. An important paralog of this gene is SPINK14. |
| Molecular Mass : | 35.6 kDa |
| AA Sequence : | MKITGGLLLLCTVVYFCSSSEAASLSPKKVDCSIYKKYPVVAIPCPITYLPVCGSDYITYGNECHLCTESLKSNGRVQFLHDGSC |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | SPINK7 serine peptidase inhibitor, Kazal type 7 (putative) [ Homo sapiens ] |
| Official Symbol | SPINK7 |
| Synonyms | ECG2; ECRG2 |
| Gene ID | 84651 |
| mRNA Refseq | NM_032566 |
| Protein Refseq | NP_115955 |
| MIM | 617288 |
| UniProt ID | P58062 |
| ◆ Recombinant Proteins | ||
| SPINK7-4746HF | Recombinant Full Length Human SPINK7 Protein, GST-tagged | +Inquiry |
| SPINK7-6633H | Recombinant Human SPINK7 Protein (Ser20-Cys85), C-His tagged | +Inquiry |
| SPINK7-3792C | Recombinant Chicken SPINK7 | +Inquiry |
| SPINK7-206H | Recombinant Human serine peptidase inhibitor, Kazal type 7 (putative), His-tagged | +Inquiry |
| SPINK7-0331C | Recombinant Chicken SPINK7 Protein (Ala25-Cys210), N-His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SPINK7-1509HCL | Recombinant Human SPINK7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SPINK7 Products
Required fields are marked with *
My Review for All SPINK7 Products
Required fields are marked with *
