Recombinant Full Length Human SPRR3 Protein
| Cat.No. : | SPRR3-493HF | 
| Product Overview : | Recombinant full length Human SPRR3 with N terminal proprietary tag; Predicted MWt 43.82 kDa. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | In Vitro Cell Free System | 
| Protein Length : | 161 amino acids | 
| Description : | Small proline-rich protein 3 is a protein that in humans is encoded by the SPRR3 gene. | 
| Form : | Liquid | 
| Molecular Mass : | 43.820kDa inclusive of tags | 
| AA Sequence : | MSSYQQKQTFTPPPQLQQQQVKQPSQPPPQEIFVPTTKEP CHSKVPQPGNTKIPEPGCTKVPEPGCTKVPEPGCTKVPEP GCTKVPEPGCTKVPEPGYTKVPEPGSIKVPDQGFIKFPEP GAIKVPEQGYTKVPVPGYTKVPEPCPSTVTPGPAQQKTKQ K | 
| Purity : | Proprietary Purification | 
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. | 
| Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. | 
| Gene Name | SPRR3 small proline-rich protein 3 [ Homo sapiens ] | 
| Official Symbol | SPRR3 | 
| Synonyms | SPRR3; small proline-rich protein 3 | 
| Gene ID | 6707 | 
| mRNA Refseq | NM_001097589 | 
| Protein Refseq | NP_001091058 | 
| MIM | 182271 | 
| UniProt ID | Q9UBC9 | 
| ◆ Recombinant Proteins | ||
| SPRR3-2730H | Recombinant Human SPRR3 Protein, His-tagged | +Inquiry | 
| SPRR3-2937H | Recombinant Human SPRR3, GST-tagged | +Inquiry | 
| SPRR3-15940M | Recombinant Mouse SPRR3 Protein | +Inquiry | 
| SPRR3-3523H | Recombinant Human SPRR3 protein, His-SUMO-tagged | +Inquiry | 
| SPRR3-29265TH | Recombinant Human SPRR3 | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| SPRR3-1493HCL | Recombinant Human SPRR3 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SPRR3 Products
Required fields are marked with *
My Review for All SPRR3 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            