Recombinant Full Length Human SPRR3 Protein
| Cat.No. : | SPRR3-493HF |
| Product Overview : | Recombinant full length Human SPRR3 with N terminal proprietary tag; Predicted MWt 43.82 kDa. |
- Specification
- Gene Information
- Related Products
| Description : | Small proline-rich protein 3 is a protein that in humans is encoded by the SPRR3 gene. |
| Source : | In Vitro Cell Free System |
| Species : | Human |
| Form : | Liquid |
| Molecular Mass : | 43.820kDa inclusive of tags |
| Protein Length : | 161 amino acids |
| AA Sequence : | MSSYQQKQTFTPPPQLQQQQVKQPSQPPPQEIFVPTTKEP CHSKVPQPGNTKIPEPGCTKVPEPGCTKVPEPGCTKVPEP GCTKVPEPGCTKVPEPGYTKVPEPGSIKVPDQGFIKFPEP GAIKVPEQGYTKVPVPGYTKVPEPCPSTVTPGPAQQKTKQ K |
| Purity : | Proprietary Purification |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
| Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
| Gene Name : | SPRR3 small proline-rich protein 3 [ Homo sapiens ] |
| Official Symbol : | SPRR3 |
| Synonyms : | SPRR3; small proline-rich protein 3 |
| Gene ID : | 6707 |
| mRNA Refseq : | NM_001097589 |
| Protein Refseq : | NP_001091058 |
| MIM : | 182271 |
| UniProt ID : | Q9UBC9 |
Products Types
| ◆ Recombinant Protein | ||
| SPRR3-8687M | Recombinant Mouse SPRR3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SPRR3-2730H | Recombinant Human SPRR3 Protein, His-tagged | +Inquiry |
| SPRR3-29265TH | Recombinant Human SPRR3 | +Inquiry |
| SPRR3-3523H | Recombinant Human SPRR3 protein, His-SUMO-tagged | +Inquiry |
| SPRR3-15940M | Recombinant Mouse SPRR3 Protein | +Inquiry |
| ◆ Lysates | ||
| SPRR3-1493HCL | Recombinant Human SPRR3 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket
