Recombinant Full Length Human SPRR3 Protein
| Cat.No. : | SPRR3-493HF |
| Product Overview : | Recombinant full length Human SPRR3 with N terminal proprietary tag; Predicted MWt 43.82 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Protein Length : | 161 amino acids |
| Description : | Small proline-rich protein 3 is a protein that in humans is encoded by the SPRR3 gene. |
| Form : | Liquid |
| Molecular Mass : | 43.820kDa inclusive of tags |
| AA Sequence : | MSSYQQKQTFTPPPQLQQQQVKQPSQPPPQEIFVPTTKEP CHSKVPQPGNTKIPEPGCTKVPEPGCTKVPEPGCTKVPEP GCTKVPEPGCTKVPEPGYTKVPEPGSIKVPDQGFIKFPEP GAIKVPEQGYTKVPVPGYTKVPEPCPSTVTPGPAQQKTKQ K |
| Purity : | Proprietary Purification |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
| Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
| Gene Name | SPRR3 small proline-rich protein 3 [ Homo sapiens ] |
| Official Symbol | SPRR3 |
| Synonyms | SPRR3; small proline-rich protein 3 |
| Gene ID | 6707 |
| mRNA Refseq | NM_001097589 |
| Protein Refseq | NP_001091058 |
| MIM | 182271 |
| UniProt ID | Q9UBC9 |
| ◆ Recombinant Proteins | ||
| SPRR3-29265TH | Recombinant Human SPRR3 | +Inquiry |
| SPRR3-3523H | Recombinant Human SPRR3 protein, His-SUMO-tagged | +Inquiry |
| SPRR3-2730H | Recombinant Human SPRR3 Protein, His-tagged | +Inquiry |
| SPRR3-8687M | Recombinant Mouse SPRR3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SPRR3-2937H | Recombinant Human SPRR3, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SPRR3-1493HCL | Recombinant Human SPRR3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SPRR3 Products
Required fields are marked with *
My Review for All SPRR3 Products
Required fields are marked with *
