Recombinant Human SPRR3
Cat.No. : | SPRR3-29265TH |
Product Overview : | Recombinant full length Human SPRR3 with N terminal proprietary tag; Predicted MWt 43.82 kDa. |
- Specification
- Gene Information
- Related Products
Description : | Small proline-rich protein 3 is a protein that in humans is encoded by the SPRR3 gene. |
Protein length : | 161 amino acids |
Molecular Weight : | 43.820kDa inclusive of tags |
Source : | Wheat germ |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Store at 4°C (up to 6 months). For long term storage store at -20°C |
Sequences of amino acids : | MSSYQQKQTFTPPPQLQQQQVKQPSQPPPQEIFVPTTKEP CHSKVPQPGNTKIPEPGCTKVPEPGCTKVPEPGCTKVPEP GCTKVPEPGCTKVPEPGYTKVPEPGSIKVPDQGFIKFPEP GAIKVPEQGYTKVPVPGYTKVPEPCPSTVTPGPAQQKTKQ K |
Sequence Similarities : | Belongs to the cornifin (SPRR) family. |
Gene Name : | SPRR3 small proline-rich protein 3 [ Homo sapiens ] |
Official Symbol : | SPRR3 |
Synonyms : | SPRR3; small proline-rich protein 3; |
Gene ID : | 6707 |
mRNA Refseq : | NM_001097589 |
Protein Refseq : | NP_001091058 |
MIM : | 182271 |
Uniprot ID : | Q9UBC9 |
Chromosome Location : | 1q21-q22 |
Function : | protein binding; structural molecule activity; |
Products Types
◆ Recombinant Protein | ||
SPRR3-2730H | Recombinant Human SPRR3 Protein, His-tagged | +Inquiry |
SPRR3-8687M | Recombinant Mouse SPRR3 Protein, His (Fc)-Avi-tagged | +Inquiry |
SPRR3-15940M | Recombinant Mouse SPRR3 Protein | +Inquiry |
SPRR3-2937H | Recombinant Human SPRR3, GST-tagged | +Inquiry |
SPRR3-3523H | Recombinant Human SPRR3 protein, His-SUMO-tagged | +Inquiry |
◆ Lysates | ||
SPRR3-1493HCL | Recombinant Human SPRR3 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket