Recombinant Human SPRR3
| Cat.No. : | SPRR3-29265TH |
| Product Overview : | Recombinant full length Human SPRR3 with N terminal proprietary tag; Predicted MWt 43.82 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 161 amino acids |
| Description : | Small proline-rich protein 3 is a protein that in humans is encoded by the SPRR3 gene. |
| Molecular Weight : | 43.820kDa inclusive of tags |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Store at 4°C (up to 6 months). For long term storage store at -20°C |
| Sequences of amino acids : | MSSYQQKQTFTPPPQLQQQQVKQPSQPPPQEIFVPTTKEP CHSKVPQPGNTKIPEPGCTKVPEPGCTKVPEPGCTKVPEP GCTKVPEPGCTKVPEPGYTKVPEPGSIKVPDQGFIKFPEP GAIKVPEQGYTKVPVPGYTKVPEPCPSTVTPGPAQQKTKQ K |
| Sequence Similarities : | Belongs to the cornifin (SPRR) family. |
| Gene Name | SPRR3 small proline-rich protein 3 [ Homo sapiens ] |
| Official Symbol | SPRR3 |
| Synonyms | SPRR3; small proline-rich protein 3; |
| Gene ID | 6707 |
| mRNA Refseq | NM_001097589 |
| Protein Refseq | NP_001091058 |
| MIM | 182271 |
| Uniprot ID | Q9UBC9 |
| Chromosome Location | 1q21-q22 |
| Function | protein binding; structural molecule activity; |
| ◆ Recombinant Proteins | ||
| SPRR3-15940M | Recombinant Mouse SPRR3 Protein | +Inquiry |
| SPRR3-493HF | Recombinant Full Length Human SPRR3 Protein | +Inquiry |
| SPRR3-2937H | Recombinant Human SPRR3, GST-tagged | +Inquiry |
| SPRR3-29265TH | Recombinant Human SPRR3 | +Inquiry |
| SPRR3-2730H | Recombinant Human SPRR3 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SPRR3-1493HCL | Recombinant Human SPRR3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SPRR3 Products
Required fields are marked with *
My Review for All SPRR3 Products
Required fields are marked with *
