Recombinant Full Length Human SSMEM1 Protein, GST-tagged

• Cat.No.: SSMEM1-2626HF
• Product Overview: Human SSMEM1 full-length ORF (BAC05126.1, 1 a.a. - 244 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 244 amino acids
• Description: SSMEM1 (Serine Rich Single-Pass Membrane Protein 1) is a Protein Coding gene.
• Molecular Mass: 54.6 kDa
• AA Sequence: MGDLFSLFWEVDPPPIPVNCAIPNQDYECWKDDSCGTIGSFLLWYFVIVFVLMFFSRASVWMSEDKKDEGSGTSTSVRKASKETSCKRQSKDSAWDPSQTMKKPKQNQLTPVTNSEVALVNAYPEQRRARRQSQFNEVNQNQHDSDTTEYGSEESNSEASSWKESESEHHPSPDSIKRRKMAQRQRNLGSYQMSERHCLHCKALRTNEWLAHHSRQKPSVTPPMKRDSQEESSISDINKKFSKF
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: SSMEM1 serine rich single-pass membrane protein 1 [ Homo sapiens (human) ]
• Official Symbol: SSMEM1
• Synonyms: SSMEM1; serine rich single-pass membrane protein 1; Serine Rich Single-Pass Membrane Protein 1; C7orf45; Serine-Rich Single-Pass Membrane Protein 1; Chromosome 7 Open Reading Frame 45
• Gene ID: 136263
• mRNA Refseq: NM_145268
• Protein Refseq: NP_660311
• UniProt ID: Q8WWF3