Recombinant Full Length Human SSMEM1 Protein, GST-tagged

Cat.No. : SSMEM1-2626HF
Product Overview : Human SSMEM1 full-length ORF (BAC05126.1, 1 a.a. - 244 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 244 amino acids
Description : SSMEM1 (Serine Rich Single-Pass Membrane Protein 1) is a Protein Coding gene.
Molecular Mass : 54.6 kDa
AA Sequence : MGDLFSLFWEVDPPPIPVNCAIPNQDYECWKDDSCGTIGSFLLWYFVIVFVLMFFSRASVWMSEDKKDEGSGTSTSVRKASKETSCKRQSKDSAWDPSQTMKKPKQNQLTPVTNSEVALVNAYPEQRRARRQSQFNEVNQNQHDSDTTEYGSEESNSEASSWKESESEHHPSPDSIKRRKMAQRQRNLGSYQMSERHCLHCKALRTNEWLAHHSRQKPSVTPPMKRDSQEESSISDINKKFSKF
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name SSMEM1 serine rich single-pass membrane protein 1 [ Homo sapiens (human) ]
Official Symbol SSMEM1
Synonyms SSMEM1; serine rich single-pass membrane protein 1; Serine Rich Single-Pass Membrane Protein 1; C7orf45; Serine-Rich Single-Pass Membrane Protein 1; Chromosome 7 Open Reading Frame 45;
Gene ID 136263
mRNA Refseq NM_145268
Protein Refseq NP_660311
UniProt ID Q8WWF3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SSMEM1 Products

Required fields are marked with *

My Review for All SSMEM1 Products

Required fields are marked with *

0
cart-icon