Recombinant Human SSMEM1 Protein, GST-Tagged
| Cat.No. : | SSMEM1 -0146H |
| Product Overview : | Human SSMEM1 full-length ORF (BAC05126.1, 1 a.a. - 244 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | SSMEM1 (Serine Rich Single-Pass Membrane Protein 1) is a Protein Coding gene. |
| Molecular Mass : | 54.6 kDa |
| AA Sequence : | MGDLFSLFWEVDPPPIPVNCAIPNQDYECWKDDSCGTIGSFLLWYFVIVFVLMFFSRASVWMSEDKKDEGSGTSTSVRKASKETSCKRQSKDSAWDPSQTMKKPKQNQLTPVTNSEVALVNAYPEQRRARRQSQFNEVNQNQHDSDTTEYGSEESNSEASSWKESESEHHPSPDSIKRRKMAQRQRNLGSYQMSERHCLHCKALRTNEWLAHHSRQKPSVTPPMKRDSQEESSISDINKKFSKF |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | SSMEM1 serine rich single-pass membrane protein 1 [ Homo sapiens (human) ] |
| Official Symbol | SSMEM1 |
| Synonyms | SSMEM1; serine rich single-pass membrane protein 1; Serine Rich Single-Pass Membrane Protein 1; C7orf45; Serine-Rich Single-Pass Membrane Protein 1; Chromosome 7 Open Reading Frame 45; |
| Gene ID | 136263 |
| mRNA Refseq | NM_145268 |
| Protein Refseq | NP_660311 |
| UniProt ID | Q8WWF3 |
| ◆ Recombinant Proteins | ||
| RFL1771MF | Recombinant Full Length Macaca Fascicularis Uncharacterized Protein C7Orf45 Homolog(Qtsa-20413) Protein, His-Tagged | +Inquiry |
| SSMEM1-979C | Recombinant Cynomolgus SSMEM1 Protein, His-tagged | +Inquiry |
| SSMEM1-722C | Recombinant Cynomolgus Monkey SSMEM1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SSMEM1-2626HF | Recombinant Full Length Human SSMEM1 Protein, GST-tagged | +Inquiry |
| SSMEM1 -0146H | Recombinant Human SSMEM1 Protein, GST-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SSMEM1 Products
Required fields are marked with *
My Review for All SSMEM1 Products
Required fields are marked with *
