Recombinant Full Length Human STK11 Protein, His tagged

• Cat.No.: STK11-08H
• Product Overview: Recombinant human STK11 protein (1-433aa), fused to His-tag at N-terminus, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-433 aa
• Description: The protein encoded by this gene is a serine/threonine kinase that regulates cell polarity and energy metabolism and functions as a tumor suppressor. Mutations in this gene have been associated with the autosomal dominant Peutz-Jeghers syndrome, as well as with skin, pancreatic, and testicular cancers.
• Form: Liquid in 20mM Tris-HCl buffer (pH 8.0) containing 10% glycerol
• Molecular Mass: 51 kDa (456 aa)
• AASequence: MGSSHHHHHHSSGLVPRGSHMGSMEVVDPQQLGMFTEGELMSVGMDTFIHRIDSTEVIYQPRRKRAKLIGKYLMGDLLGEGSYGKVKEVLDSETLCRRAVKILKKKKLRRIPNGEANVKKEIQLLRRLRHKNVIQLVDVLYNEEKQKMYMVMEYCVCGMQEMLDSVPEKRFPVCQAHGYFCQLIDGLEYLHSQGIVHKDIKPGNLLLTTGGTLKISDLGVAEALHPFAADDTCRTSQGSPAFQPPEIANGLDTFSGFKVDIWSAGVTLYNITTGLYPFEGDNIYKLFENIGKGSYAIPGDCGPPLSDLLKGMLEYEPAKRFSIRQIRQHSWFRKKHPPAEAPVPIPPSPDTKDRWRSMTVVPYLEDLHGADEDEDLFDIEDDIIYTQDFTVPGQVPEEEASHNGQRRGLPKAVCMNGTEAAQLSTKSRAEGRAPNPARKACSASSKIRRLSACKQQ
• Purity: > 85% by SDS-PAGE
• Applications: SDS-PAGE, Denatured
• Notes: For research use only. This product is not intended or approved for human, diagnostics or veterinary use.
• Storage: Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
• Concentration: 0.5 mg/mL (determined by Bradford assay)
• Reference: 1. Mack HI.,et al. (2013) Virology 446 (1-2), 9-16

Gene Information

• Gene Name: STK11 serine/threonine kinase 11 [ Homo sapiens (human) ]
• Official Symbol: STK11
• Synonyms: STK11; serine/threonine kinase 11; PJS; LKB1; hLKB1; serine/threonine-protein kinase STK11; liver kinase B1; polarization-related protein LKB1; renal carcinoma antigen NY-REN-19; serine/threonine-protein kinase 11; serine/threonine-protein kinase LKB1; EC 2.7.11.1
• Gene ID: 6794
• mRNA Refseq: NM_000455
• Protein Refseq: NP_000446
• MIM: 602216
• UniProt ID: Q15831