Recombinant Human STK11 protein, His-SUMO-tagged
Cat.No. : | STK11-4447H |
Product Overview : | Recombinant Human STK11 protein(Q15831)(1-430aa), fused to N-terminal His-SUMO tag, was expressed in E. coli |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-430aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 64.3 kDa |
AA Sequence : | MEVVDPQQLGMFTEGELMSVGMDTFIHRIDSTEVIYQPRRKRAKLIGKYLMGDLLGEGSYGKVKEVLDSETLCRRAVKILKKKKLRRIPNGEANVKKEIQLLRRLRHKNVIQLVDVLYNEEKQKMYMVMEYCVCGMQEMLDSVPEKRFPVCQAHGYFCQLIDGLEYLHSQGIVHKDIKPGNLLLTTGGTLKISDLGVAEALHPFAADDTCRTSQGSPAFQPPEIANGLDTFSGFKVDIWSAGVTLYNITTGLYPFEGDNIYKLFENIGKGSYAIPGDCGPPLSDLLKGMLEYEPAKRFSIRQIRQHSWFRKKHPPAEAPVPIPPSPDTKDRWRSMTVVPYLEDLHGADEDEDLFDIEDDIIYTQDFTVPGQVPEEEASHNGQRRGLPKAVCMNGTEAAQLSTKSRAEGRAPNPARKACSASSKIRRLSAC |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | STK11 serine/threonine kinase 11 [ Homo sapiens ] |
Official Symbol | STK11 |
Synonyms | STK11; serine/threonine kinase 11; serine/threonine kinase 11 (Peutz Jeghers syndrome); serine/threonine-protein kinase STK11; LKB1; PJS; polarization related protein LKB1; liver kinase B1; polarization-related protein LKB1; renal carcinoma antigen NY-REN-19; serine/threonine-protein kinase 11; serine/threonine-protein kinase LKB1; hLKB1; |
Gene ID | 6794 |
mRNA Refseq | NM_000455 |
Protein Refseq | NP_000446 |
MIM | 602216 |
UniProt ID | Q15831 |
◆ Recombinant Proteins | ||
STK11-23H | Recombinant Human STK11 protein, His-tagged | +Inquiry |
STK11-2563Z | Recombinant Zebrafish STK11 | +Inquiry |
STK11-4447H | Recombinant Human STK11 protein, His-SUMO-tagged | +Inquiry |
STK11-2814M | Recombinant Mouse STK11 Protein (1-433 aa), His-Myc-tagged | +Inquiry |
STK11-240H | Recombinant Human STK11 protein, GST/His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
STK11-1410HCL | Recombinant Human STK11 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All STK11 Products
Required fields are marked with *
My Review for All STK11 Products
Required fields are marked with *