| Species : | Human | 
                                
                                    | Source : | Mammalian Cells | 
                                
                                    | Tag : | Flag | 
                                
                                    | Description : | Enables sphingomyelin phosphodiesterase activator activity. Involved in several processes, including cornified envelope assembly; positive regulation of immune effector process; and positive regulation of protein localization. Located in several cellular components, including basolateral plasma membrane; cytoplasmic vesicle; and lamellipodium. Part of SNARE complex. Is active in glutamatergic synapse and postsynapse. | 
                                
                                    | Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. | 
                                
                                    | Molecular Mass : | 34 kDa | 
                                
                                    | AA Sequence : | MRDRTHELRQGDDSSDEEDKERVALVVHPGTARLGSPDEEFFHKVRTIRQTIVKLGNKVQELEKQQVTIL ATPLPEESMKQELQNLRDEIKQLGREIRLQLKAIEPQKEEADENYNSVNTRMRKTQHGVLSQQFVELINK CNSMQSEYREKNVERIRRQLKITNAGMVSDEELEQMLDSGQSEVFVSNILKDTQVTRQALNEISARHSEI QQLERSIRELHDIFTFLATEVEMQGEMINRIEKNILSSADYVERGQEHVKTALENQKKARKKKVLIAICV SITVVLLAVIIGVTVVGTRTRPLEQKLISEEDLAANDILDYKDDDDKV
 | 
                                
                                    | Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. | 
                                
                                    | Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. | 
                                
                                    | Storage : | Store at -80 centigrade. | 
                                
                                    | Concentration : | >50 ug/mL as determined by microplate BCA method. | 
                                
                                    | Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. | 
                                
                                    | Protein Families : | Druggable Genome, Transmembrane | 
                                
                                    | Protein Pathways : | SNARE interactions in vesicular transport | 
                                
                                    | Full Length : | Full L. |