Recombinant Full Length Human STX4 Protein, C-Flag-tagged
Cat.No. : | STX4-1598HFL |
Product Overview : | Recombinant Full Length Human STX4 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Enables sphingomyelin phosphodiesterase activator activity. Involved in several processes, including cornified envelope assembly; positive regulation of immune effector process; and positive regulation of protein localization. Located in several cellular components, including basolateral plasma membrane; cytoplasmic vesicle; and lamellipodium. Part of SNARE complex. Is active in glutamatergic synapse and postsynapse. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 34 kDa |
AA Sequence : | MRDRTHELRQGDDSSDEEDKERVALVVHPGTARLGSPDEEFFHKVRTIRQTIVKLGNKVQELEKQQVTIL ATPLPEESMKQELQNLRDEIKQLGREIRLQLKAIEPQKEEADENYNSVNTRMRKTQHGVLSQQFVELINK CNSMQSEYREKNVERIRRQLKITNAGMVSDEELEQMLDSGQSEVFVSNILKDTQVTRQALNEISARHSEI QQLERSIRELHDIFTFLATEVEMQGEMINRIEKNILSSADYVERGQEHVKTALENQKKARKKKVLIAICV SITVVLLAVIIGVTVVGTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transmembrane |
Protein Pathways : | SNARE interactions in vesicular transport |
Full Length : | Full L. |
Gene Name | STX4 syntaxin 4 [ Homo sapiens (human) ] |
Official Symbol | STX4 |
Synonyms | STX4A; p35-2 |
Gene ID | 6810 |
mRNA Refseq | NM_004604.5 |
Protein Refseq | NP_004595.2 |
MIM | 186591 |
UniProt ID | Q12846 |
◆ Recombinant Proteins | ||
STX4-10561Z | Recombinant Zebrafish STX4 | +Inquiry |
STX4-5473R | Recombinant Rat STX4 Protein, His (Fc)-Avi-tagged | +Inquiry |
STX4-31439TH | Recombinant Human STX4 | +Inquiry |
STX4-1598HFL | Recombinant Full Length Human STX4 Protein, C-Flag-tagged | +Inquiry |
STX4-3030H | Recombinant Human STX4, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
STX4-1375HCL | Recombinant Human STX4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All STX4 Products
Required fields are marked with *
My Review for All STX4 Products
Required fields are marked with *
0
Inquiry Basket