Recombinant Full Length Human STYX Protein, C-Flag-tagged
Cat.No. : | STYX-847HFL |
Product Overview : | Recombinant Full Length Human STYX Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a pseudophosphatase, able to bind potential substrates but lacking an active catalytic loop. The encoded protein may be involved in spermiogenesis. Two transcript variants encoding the same protein have been found for these genes. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 25.3 kDa |
AA Sequence : | MEDVKLEFPSLPQCKEDAEEWTYPMRREMQEILPGLFLGPYSSAMKSKLPVLQKHGITHIICIRQNIEAN FIKPNFQQLFRYLVLDIADNPVENIIRFFPMTKEFIDGSLQMGGKVLVHGNAGISRSAAFVIAYIMETFG MKYRDAFAYVQERRFCINPNAGFVHQLQEYEAIYLAKLTIQMMSPLQIERSLSVHSGTTGSLKRTHEEED DFGTMQVATAQNGTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Phosphatase |
Full Length : | Full L. |
Gene Name | STYX serine/threonine/tyrosine interacting protein [ Homo sapiens (human) ] |
Official Symbol | STYX |
Synonyms | FLJ42934 |
Gene ID | 6815 |
mRNA Refseq | NM_145251.4 |
Protein Refseq | NP_660294.1 |
MIM | 615814 |
UniProt ID | Q8WUJ0 |
◆ Recombinant Proteins | ||
STYX-2997Z | Recombinant Zebrafish STYX | +Inquiry |
STYX-2136H | Recombinant Human STYX Protein, His (Fc)-Avi-tagged | +Inquiry |
Styx-6214M | Recombinant Mouse Styx Protein, Myc/DDK-tagged | +Inquiry |
STYX-847HFL | Recombinant Full Length Human STYX Protein, C-Flag-tagged | +Inquiry |
STYX-1935H | Recombinant Human Serine/Threonine/Tyrosine Interacting Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
STYX-1370HCL | Recombinant Human STYX 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All STYX Products
Required fields are marked with *
My Review for All STYX Products
Required fields are marked with *
0
Inquiry Basket