Recombinant Full Length Human SUCLA2 Protein, C-Flag-tagged
Cat.No. : | SUCLA2-1717HFL |
Product Overview : | Recombinant Full Length Human SUCLA2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Succinyl-CoA synthetase (SCS) is a mitochondrial matrix enzyme that acts as a heterodimer, being composed of an invariant alpha subunit and a substrate-specific beta subunit. The protein encoded by this gene is an ATP-specific SCS beta subunit that dimerizes with the SCS alpha subunit to form SCS-A, an essential component of the tricarboxylic acid cycle. SCS-A hydrolyzes ATP to convert succinate to succinyl-CoA. Defects in this gene are a cause of myopathic mitochondrial DNA depletion syndrome. A pseudogene of this gene has been found on chromosome 6. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 44.5 kDa |
AA Sequence : | MAASMFYGRLVAVATLRNHRPRTAQRAAAQVLGSSGLFNNHGLQVQQQQQRNLSLHEYMSMELLQEAGVS VPKGYVAKSPDEAYAIAKKLGSKDVVIKAQVLAGGRGKGTFESGLKGGVKIVFSPEEAKAVSSQMIGKKL FTKQTGEKGRICNQVLVCERKYPRREYYFAITMERSFQGPVLIGSSHGGVNIEDVAAESPEAIIKEPIDI EEGIKKEQALQLAQKMGFPPNIVESAAENMVKLYSLFLKYDATMIEINPMVEDSDGAVLCMDAKINFDSN SAYRQKKIFDLQDWTQEDERDKDAAKANLNYIGLDGNIGCLVNGAGLAMATMDIIKLHGGTPANFLDVGG GATVHQVTEAFKLITSDKKVLAILVNIFGGIMRCDVIAQGIVMAVKDLEIKIPVVVRLQGTRVDDAKALI ADSGLKILACDDLDEAARMVVKLSEIVTLAKQAHVDVKFQLPITRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Pathways : | Citrate cycle (TCA cycle), Metabolic pathways, Propanoate metabolism |
Full Length : | Full L. |
Gene Name | SUCLA2 succinate-CoA ligase ADP-forming subunit beta [ Homo sapiens (human) ] |
Official Symbol | SUCLA2 |
Synonyms | A-SCS; A-BETA; MTDPS5; LINC00444; SCS-betaA |
Gene ID | 8803 |
mRNA Refseq | NM_003850.3 |
Protein Refseq | NP_003841.1 |
MIM | 603921 |
UniProt ID | Q9P2R7 |
◆ Recombinant Proteins | ||
SUCLA2-2138H | Recombinant Human SUCLA2 Protein, His (Fc)-Avi-tagged | +Inquiry |
SUCLA2-754H | Recombinant Human SUCLA2 protein, His&Myc-tagged | +Inquiry |
SUCLA2-12266Z | Recombinant Zebrafish SUCLA2 | +Inquiry |
SUCLA2-731C | Recombinant Cynomolgus Monkey SUCLA2 Protein, His (Fc)-Avi-tagged | +Inquiry |
SUCLA2-1717HFL | Recombinant Full Length Human SUCLA2 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SUCLA2-1367HCL | Recombinant Human SUCLA2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SUCLA2 Products
Required fields are marked with *
My Review for All SUCLA2 Products
Required fields are marked with *
0
Inquiry Basket