Recombinant Full Length Human SUPT4H1 Protein

Cat.No. : SUPT4H1-509HF
Product Overview : Recombinant full length Human Suppressor of Ty 4 homolog 1 with N terminal proprietary tag; Predicted MWt 38.94 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Protein Length : 117 amino acids
Description : Transcription elongation factor SPT4 is a protein that in humans is encoded by the SUPT4H1 gene.
Form : Liquid
Molecular Mass : 38.940kDa inclusive of tags
AA Sequence : MALETVPKDLRHLRACLLCSLVKTIDQFEYDGCDNCDAYL QMKGNREMVYDCTSSSFDGIIAMMSPEDSWVSKWQRVSNF KPGVYAVSVTGRLPQGIVRELKSRGVAYKSRDTAIKT
Purity : Proprietary Purification
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
Storage Buffer : pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.
Gene Name SUPT4H1 suppressor of Ty 4 homolog 1 (S. cerevisiae) [ Homo sapiens ]
Official Symbol SUPT4H1
Synonyms SUPT4H1; suppressor of Ty 4 homolog 1 (S. cerevisiae); suppressor of Ty (S.cerevisiae) 4 homolog 1 , SUPT4H; transcription elongation factor SPT4; SPT4H
Gene ID 6827
mRNA Refseq NM_003168
Protein Refseq NP_003159
MIM 603555
UniProt ID P63272

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SUPT4H1 Products

Required fields are marked with *

My Review for All SUPT4H1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon