Recombinant Full Length Human SUPT4H1 Protein

• Cat.No.: SUPT4H1-509HF
• Product Overview: Recombinant full length Human Suppressor of Ty 4 homolog 1 with N terminal proprietary tag; Predicted MWt 38.94 kDa.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Protein Length: 117 amino acids
• Description: Transcription elongation factor SPT4 is a protein that in humans is encoded by the SUPT4H1 gene.
• Form: Liquid
• Molecular Mass: 38.940kDa inclusive of tags
• AA Sequence: MALETVPKDLRHLRACLLCSLVKTIDQFEYDGCDNCDAYL QMKGNREMVYDCTSSSFDGIIAMMSPEDSWVSKWQRVSNF KPGVYAVSVTGRLPQGIVRELKSRGVAYKSRDTAIKT
• Purity: Proprietary Purification
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
• Storage Buffer: pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.

Gene Information

• Gene Name: SUPT4H1 suppressor of Ty 4 homolog 1 (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: SUPT4H1
• Synonyms: SUPT4H1; suppressor of Ty 4 homolog 1 (S. cerevisiae); suppressor of Ty (S.cerevisiae) 4 homolog 1 , SUPT4H; transcription elongation factor SPT4; SPT4H
• Gene ID: 6827
• mRNA Refseq: NM_003168
• Protein Refseq: NP_003159
• MIM: 603555
• UniProt ID: P63272