Recombinant Full Length Human SUPT4H1 Protein
| Cat.No. : | SUPT4H1-509HF |
| Product Overview : | Recombinant full length Human Suppressor of Ty 4 homolog 1 with N terminal proprietary tag; Predicted MWt 38.94 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Protein Length : | 117 amino acids |
| Description : | Transcription elongation factor SPT4 is a protein that in humans is encoded by the SUPT4H1 gene. |
| Form : | Liquid |
| Molecular Mass : | 38.940kDa inclusive of tags |
| AA Sequence : | MALETVPKDLRHLRACLLCSLVKTIDQFEYDGCDNCDAYL QMKGNREMVYDCTSSSFDGIIAMMSPEDSWVSKWQRVSNF KPGVYAVSVTGRLPQGIVRELKSRGVAYKSRDTAIKT |
| Purity : | Proprietary Purification |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
| Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
| Gene Name | SUPT4H1 suppressor of Ty 4 homolog 1 (S. cerevisiae) [ Homo sapiens ] |
| Official Symbol | SUPT4H1 |
| Synonyms | SUPT4H1; suppressor of Ty 4 homolog 1 (S. cerevisiae); suppressor of Ty (S.cerevisiae) 4 homolog 1 , SUPT4H; transcription elongation factor SPT4; SPT4H |
| Gene ID | 6827 |
| mRNA Refseq | NM_003168 |
| Protein Refseq | NP_003159 |
| MIM | 603555 |
| UniProt ID | P63272 |
| ◆ Recombinant Proteins | ||
| SUPT4H1-8877M | Recombinant Mouse SUPT4H1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SUPT4H1-509HF | Recombinant Full Length Human SUPT4H1 Protein | +Inquiry |
| SUPT4H1-4564R | Recombinant Rhesus monkey SUPT4H1 Protein, His-tagged | +Inquiry |
| SUPT4H1-992C | Recombinant Cynomolgus SUPT4H1 Protein, His-tagged | +Inquiry |
| SUPT4H1-6165H | Recombinant Human SUPT4H1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SUPT4H1-1338HCL | Recombinant Human SUPT4H1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SUPT4H1 Products
Required fields are marked with *
My Review for All SUPT4H1 Products
Required fields are marked with *
