Recombinant Full Length Human SUPT4H1 Protein
| Cat.No. : | SUPT4H1-509HF |
| Product Overview : | Recombinant full length Human Suppressor of Ty 4 homolog 1 with N terminal proprietary tag; Predicted MWt 38.94 kDa. |
- Specification
- Gene Information
- Related Products
| Description : | Transcription elongation factor SPT4 is a protein that in humans is encoded by the SUPT4H1 gene. |
| Source : | In Vitro Cell Free System |
| Species : | Human |
| Form : | Liquid |
| Molecular Mass : | 38.940kDa inclusive of tags |
| Protein Length : | 117 amino acids |
| AA Sequence : | MALETVPKDLRHLRACLLCSLVKTIDQFEYDGCDNCDAYL QMKGNREMVYDCTSSSFDGIIAMMSPEDSWVSKWQRVSNF KPGVYAVSVTGRLPQGIVRELKSRGVAYKSRDTAIKT |
| Purity : | Proprietary Purification |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
| Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
| Gene Name : | SUPT4H1 suppressor of Ty 4 homolog 1 (S. cerevisiae) [ Homo sapiens ] |
| Official Symbol : | SUPT4H1 |
| Synonyms : | SUPT4H1; suppressor of Ty 4 homolog 1 (S. cerevisiae); suppressor of Ty (S.cerevisiae) 4 homolog 1 , SUPT4H; transcription elongation factor SPT4; SPT4H |
| Gene ID : | 6827 |
| mRNA Refseq : | NM_003168 |
| Protein Refseq : | NP_003159 |
| MIM : | 603555 |
| UniProt ID : | P63272 |
Products Types
| ◆ Recombinant Protein | ||
| SUPT4H1-8877M | Recombinant Mouse SUPT4H1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SUPT4H1-735C | Recombinant Cynomolgus Monkey SUPT4H1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SUPT4H1-4380R | Recombinant Rhesus Macaque SUPT4H1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SUPT4H1-16247M | Recombinant Mouse SUPT4H1 Protein | +Inquiry |
| SUPT4H1-992C | Recombinant Cynomolgus SUPT4H1 Protein, His-tagged | +Inquiry |
| ◆ Lysates | ||
| SUPT4H1-1338HCL | Recombinant Human SUPT4H1 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket
