Recombinant Full Length Human synaptonemal complex protein 3 Protein, His-tagged

Cat.No. : SYCP3-12HFL
Product Overview : Recombinant Full Length Human synaptonemal complex protein 3 Protein (1-236 aa) with His tag was expressed in E. coli.
Availability July 31, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-236 aa
Description : This gene encodes an essential structural component of the synaptonemal complex. This complex is involved in synapsis, recombination and segregation of meiotic chromosomes. Mutations in this gene are associated with azoospermia in males and susceptibility to pregnancy loss in females. Alternate splicing results in multiple transcript variants that encode the same protein.
Tag : His
Molecular Mass : 29 kDa
AA Sequence : MVSSGKKYSRKSGKPSVEDQFTRAYDFETEDKKDLSGSEEDVIEGKTAVIEKRRKKRSSAGVVEDMGGEVQNMLEGVGVDINKALLAKRKRLEMYTKASLKTSNQKIEHVWKTQQDQRQKLNQEYSQQFLTLFQQWDLDMQKAEEQEEKILNMFRQQQKILQQSRIVQSQRLKTIKQLYEQFIKSMEELEKNHDNLLTGAQNEFKKEMAMLQKKIMMETQQQEIASVRKSLQSMLFHHHHHHHH
Endotoxin : < 1 EU/μg by LAL
Purity : > 95% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Storage Buffer : Sterile PBS, pH7.4, 0.1% SKL
Concentration : 1 mg/mL by BCA
Gene Name SYCP3 synaptonemal complex protein 3 [ Homo sapiens (human) ]
Official Symbol SYCP3
Synonyms SYCP3; synaptonemal complex protein 3; COR1; SCP3; SPGF4; MGC71888;
Gene ID 50511
mRNA Refseq NM_001177948
Protein Refseq NP_001171419
MIM 604759
UniProt ID Q8IZU3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SYCP3 Products

Required fields are marked with *

My Review for All SYCP3 Products

Required fields are marked with *

0
cart-icon