Recombinant Full Length Human synaptonemal complex protein 3 Protein, His-tagged
Cat.No. : | SYCP3-12HFL |
Product Overview : | Recombinant Full Length Human synaptonemal complex protein 3 Protein (1-236 aa) with His tag was expressed in E. coli. |
Availability | September 18, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-236 aa |
Description : | This gene encodes an essential structural component of the synaptonemal complex. This complex is involved in synapsis, recombination and segregation of meiotic chromosomes. Mutations in this gene are associated with azoospermia in males and susceptibility to pregnancy loss in females. Alternate splicing results in multiple transcript variants that encode the same protein. |
Tag : | His |
Molecular Mass : | 29 kDa |
AA Sequence : | MVSSGKKYSRKSGKPSVEDQFTRAYDFETEDKKDLSGSEEDVIEGKTAVIEKRRKKRSSAGVVEDMGGEVQNMLEGVGVDINKALLAKRKRLEMYTKASLKTSNQKIEHVWKTQQDQRQKLNQEYSQQFLTLFQQWDLDMQKAEEQEEKILNMFRQQQKILQQSRIVQSQRLKTIKQLYEQFIKSMEELEKNHDNLLTGAQNEFKKEMAMLQKKIMMETQQQEIASVRKSLQSMLFHHHHHHHH |
Endotoxin : | < 1 EU/μg by LAL |
Purity : | > 95% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Sterile PBS, pH7.4, 0.1% SKL |
Concentration : | 1 mg/mL by BCA |
Gene Name | SYCP3 synaptonemal complex protein 3 [ Homo sapiens (human) ] |
Official Symbol | SYCP3 |
Synonyms | SYCP3; synaptonemal complex protein 3; COR1; SCP3; SPGF4; MGC71888; |
Gene ID | 50511 |
mRNA Refseq | NM_001177948 |
Protein Refseq | NP_001171419 |
MIM | 604759 |
UniProt ID | Q8IZU3 |
◆ Recombinant Proteins | ||
SYCP3-3774Z | Recombinant Zebrafish SYCP3 | +Inquiry |
SYCP3-5516R | Recombinant Rat SYCP3 Protein, His (Fc)-Avi-tagged | +Inquiry |
SYCP3-30175H | Recombinant Human SYCP3 protein, GST-tagged | +Inquiry |
Sycp3-4857M | Recombinant Mouse Sycp3 protein | +Inquiry |
SYCP3-12HFL | Recombinant Full Length Human synaptonemal complex protein 3 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SYCP3-1322HCL | Recombinant Human SYCP3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SYCP3 Products
Required fields are marked with *
My Review for All SYCP3 Products
Required fields are marked with *