Recombinant Human SYCP3 protein, GST-tagged
Cat.No. : | SYCP3-30175H |
Product Overview : | Recombinant Human SYCP3 protein(137-236 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 137-236 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | DLDMQKAEEQEEKILNMFRQQQKILQQSRIVQSQRLKTIKQLYEQFIKSMEELEKNHDNLLTGAQNEFKKEMAMLQKKIMMETQQQEIASVRKSLQSMLF |
Gene Name | SYCP3 synaptonemal complex protein 3 [ Homo sapiens ] |
Official Symbol | SYCP3 |
Synonyms | SYCP3; synaptonemal complex protein 3; COR1; SCP3; SPGF4; MGC71888; |
Gene ID | 50511 |
mRNA Refseq | NM_001177948 |
Protein Refseq | NP_001171419 |
MIM | 604759 |
UniProt ID | Q8IZU3 |
◆ Recombinant Proteins | ||
SYCP3-30174H | Recombinant Human SYCP3 protein, GST-tagged | +Inquiry |
SYCP3-3774Z | Recombinant Zebrafish SYCP3 | +Inquiry |
SYCP3-995C | Recombinant Cynomolgus SYCP3 Protein, His-tagged | +Inquiry |
Sycp3-4856M | Recombinant Mouse Sycp3 protein, Avi-tagged, Biotinylated | +Inquiry |
Sycp3-6243M | Recombinant Mouse Sycp3 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SYCP3-1322HCL | Recombinant Human SYCP3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SYCP3 Products
Required fields are marked with *
My Review for All SYCP3 Products
Required fields are marked with *
0
Inquiry Basket