Recombinant Human SYCP3 protein, GST-tagged

• Cat.No.: SYCP3-30175H
• Product Overview: Recombinant Human SYCP3 protein(137-236 aa), fused with N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 137-236 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage.
  After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.
• AA Sequence: DLDMQKAEEQEEKILNMFRQQQKILQQSRIVQSQRLKTIKQLYEQFIKSMEELEKNHDNLLTGAQNEFKKEMAMLQKKIMMETQQQEIASVRKSLQSMLF

Gene Information

• Gene Name: SYCP3 synaptonemal complex protein 3 [ Homo sapiens ]
• Official Symbol: SYCP3
• Synonyms: SYCP3; synaptonemal complex protein 3; COR1; SCP3; SPGF4; MGC71888
• Gene ID: 50511
• mRNA Refseq: NM_001177948
• Protein Refseq: NP_001171419
• MIM: 604759
• UniProt ID: Q8IZU3