Recombinant Full Length Human T-Cell Surface Glycoprotein Cd3 Delta Chain(Cd3D) Protein, His-Tagged
| Cat.No. : | RFL12764HF |
| Product Overview : | Recombinant Full Length Human T-cell surface glycoprotein CD3 delta chain(CD3D) Protein (P04234) (22-171aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length of Mature Protein (22-171) |
| Form : | Lyophilized powder |
| AA Sequence : | FKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDLGKRILDPRGIYRCNGTDIYKDKESTVQVHYRMCQSCVELDPATVAGIIVTDVIATLLLALGVFCFAGHETGRLSGAADTQALLRNDQVYQPLRDRDDAQYSHLGGNWARNK |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | CD3D |
| Synonyms | CD3D; T3D; T-cell surface glycoprotein CD3 delta chain; T-cell receptor T3 delta chain; CD antigen CD3d |
| UniProt ID | P04234 |
| ◆ Recombinant Proteins | ||
| CD3D-1458H | Recombinant Human CD3D Protein (Phe22-Ala105), N-His tagged | +Inquiry |
| CD3D-1250R | Recombinant Rat CD3D Protein | +Inquiry |
| CD3D-1901C | Recombinant Cattle CD3D protein, His & GST-tagged | +Inquiry |
| CD3D-1902H | Recombinant Human CD3D protein, His & S-tagged | +Inquiry |
| CD3D-3722H | Recombinant Human CD3D protein, rFc-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CD3D-1274HCL | Recombinant Human CD3D cell lysate | +Inquiry |
| CD3D-1466CCL | Recombinant Cynomolgus CD3D cell lysate | +Inquiry |
| CD3D-1381MCL | Recombinant Mouse CD3D cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD3D Products
Required fields are marked with *
My Review for All CD3D Products
Required fields are marked with *
