Recombinant Full Length Human T-Cell Surface Glycoprotein Cd8 Beta Chain(Cd8B) Protein, His-Tagged
Cat.No. : | RFL18691HF |
Product Overview : | Recombinant Full Length Human T-cell surface glycoprotein CD8 beta chain(CD8B) Protein (P10966) (22-210aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (22-210) |
Form : | Lyophilized powder |
AA Sequence : | LQQTPAYIKVQTNKMVMLSCEAKISLSNMRIYWLRQRQAPSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFILNLTSVKPEDSGIYFCMIVGSPELTFGKGTQLSVVDFLPTTAQPTKKSTLKKRVCRLPRPETQKGPLCSPITLGLLVAGVLVLLVSLGVAIHLCCRRRRARLRFMKQFYK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CD8B |
Synonyms | CD8B; CD8B1; T-cell surface glycoprotein CD8 beta chain; CD antigen CD8b |
UniProt ID | P10966 |
◆ Recombinant Proteins | ||
CD8B-5024H | Recombinant Human CD8B, His-tagged | +Inquiry |
CD8B-5305H | Recombinant Human CD8B Protein (Met1-Pro170), C-Fc tagged | +Inquiry |
CD8B-707R | Recombinant Rabbit CD8B Protein, His&GST-tagged | +Inquiry |
CD8B-1042H | Recombinant Human CD8B protein(Met1-Pro170), Biotinylated | +Inquiry |
CD8B-27892TH | Recombinant Human CD8B | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD8B-001HCL | Recombinant Human CD8B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD8B Products
Required fields are marked with *
My Review for All CD8B Products
Required fields are marked with *