Recombinant Human CD8B
Cat.No. : | CD8B-27892TH |
Product Overview : | Recombinant full length Human CD8 beta with a proprietary tag; Predicted MW 52.8 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 243 amino acids |
Description : | The CD8 antigen is a cell surface glycoprotein found on most cytotoxic T lymphocytes that mediates efficient cell-cell interactions within the immune system. The CD8 antigen, acting as a coreceptor, and the T-cell receptor on the T lymphocyte recognize antigens displayed by an antigen presenting cell (APC) in the context of class I MHC molecules. The functional coreceptor is either a homodimer composed of two alpha chains, or a heterodimer composed of one alpha and one beta chain. Both alpha and beta chains share significant homology to immunoglobulin variable light chains. This gene encodes the CD8 beta chain isoforms. Multiple alternatively spliced transcript variants encoding distinct membrane associated or secreted isoforms have been described. A pseudogene, also located on chromosome 2, has been identified. |
Molecular Weight : | 52.800kDa inclusive of tags |
Tissue specificity : | Isoform 1, isoform 3, isoform 5, isoform 6, isoform 7 and isoform 8 are expressed in both thymus and peripheral CD8+ T-cells. Expression of isoform 1 is higher in thymus CD8+ T-cells than in peripheral CD8+ T-cells. Expression of isoform 6 is higher in pe |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.31% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MRPRLWLLLAAQLTVLHGNSVLQQTPAYIKVQTNKMVMLSCEAKISLSNMRIYWLRQRQAPSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFILNLTSVKPEDSGIYFCMIVGSPELTFGKGTQLSVVDFLPTTAQPTKKSTLKKRVCRLPRPETQKGPLCSPITLGLLVAGVLVLLVSLGVAIHLCCRRRRARLRFMKQPQGEGISGTFVPQCLHGYYSNTTTSQKLLNPWILKT |
Sequence Similarities : | Contains 1 Ig-like V-type (immunoglobulin-like) domain. |
Gene Name | CD8B CD8b molecule [ Homo sapiens ] |
Official Symbol | CD8B |
Synonyms | CD8B; CD8b molecule; CD8 antigen, beta polypeptide 1 (p37) , CD8B1; T-cell surface glycoprotein CD8 beta chain; |
Gene ID | 926 |
mRNA Refseq | NM_001178100 |
Protein Refseq | NP_001171571 |
MIM | 186730 |
Uniprot ID | P10966 |
Chromosome Location | 2p12 |
Pathway | Adaptive Immune System, organism-specific biosystem; Antigen processing and presentation, organism-specific biosystem; Antigen processing and presentation, conserved biosystem; Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; |
Function | MHC class I protein binding; coreceptor activity; protein binding; |
◆ Recombinant Proteins | ||
CD8B-253H | Recombinant Human CD8B | +Inquiry |
CD8B-3819H | Recombinant Human CD8B protein, His-tagged | +Inquiry |
CD8B-10983H | Recombinant Human CD8B, GST-tagged | +Inquiry |
CD8B-0880H | Recombinant Human CD8B Protein, GST-Tagged | +Inquiry |
CD8B-423H | Recombinant Human CD8b molecule, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD8B-001HCL | Recombinant Human CD8B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD8B Products
Required fields are marked with *
My Review for All CD8B Products
Required fields are marked with *
0
Inquiry Basket