Recombinant Full Length Human TAZ Protein
Cat.No. : | TAZ-522HF |
Product Overview : | Recombinant full length Human Tafazzin/TAZ protein with an N terminal proprietary tag; predicted mwt: 54.56 kDa with the tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 262 amino acids |
Description : | This gene encodes a protein that is expressed at high levels in cardiac and skeletal muscle. Mutations in this gene have been associated with a number of clinical disorders including Barth syndrome, dilated cardiomyopathy (DCM), hypertrophic DCM, endocardial fibroelastosis, and left ventricular noncompaction (LVNC). Multiple transcript variants encoding different isoforms have been described. A long form and a short form of each of these isoforms is produced; the short form lacks a hydrophobic leader sequence and may exist as a cytoplasmic protein rather than being membrane-bound. Other alternatively spliced transcripts have been described but the full-length nature of all these transcripts is not known. |
Form : | Liquid |
Molecular Mass : | 54.560kDa inclusive of tags |
AA Sequence : | MPLHVKWPFPAVPPLTWTLASSVVMGLVGTYSCFWTSEWA QAEAGPPGYPCPAGGILKLRHIWNLKLMRWTPAAADICFT KELHSHFFSLGKCVPVCRGDGVYQKGMDFILEKLNHGDWV HIFPEGIGRLIAECHLNPIILPLWHVGEPGDGDREMASGV GGLGLPLVPGCPAPPHVWPSVHCAAGMNDVLPNSPPYFPR FGQKITVLIGKPFSALPVLERLRAENKSAVEMRKALTDFI QEEFQHLKTQAEQLHNHLQPGR |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | TAZ tafazzin [ Homo sapiens ] |
Official Symbol | TAZ |
Synonyms | TAZ; tafazzin; cardiomyopathy, dilated 3A (X linked) , CMD3A, EFE, EFE2, endocardial fibroelastosis 2; Barth syndrome; BTHS; G4.5; XAP 2 |
Gene ID | 6901 |
mRNA Refseq | NM_000116 |
Protein Refseq | NP_000107 |
MIM | 300394 |
UniProt ID | Q16635 |
◆ Cell & Tissue Lysates | ||
TAZ-1233HCL | Recombinant Human TAZ 293 Cell Lysate | +Inquiry |
TAZ-1234HCL | Recombinant Human TAZ 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TAZ Products
Required fields are marked with *
My Review for All TAZ Products
Required fields are marked with *
0
Inquiry Basket