Recombinant Full Length Human TCEB1 Protein

Cat.No. : TCEB1-521HF
Product Overview : Recombinant full length Human TCEB1 with N terminal proprietary tag; Predicted MWt 38.06 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Protein Length : 112 amino acids
Description : This gene encodes the protein elongin C, which is a subunit of the transcription factor B (SIII) complex. The SIII complex is composed of elongins A/A2, B and C. It activates elongation by RNA polymerase II by suppressing transient pausing of the polymerase at many sites within transcription units. Elongin A functions as the transcriptionally active component of the SIII complex, whereas elongins B and C are regulatory subunits. Elongin A2 is specifically expressed in the testis, and capable of forming a stable complex with elongins B and C. The von Hippel-Lindau tumor suppressor protein binds to elongins B and C, and thereby inhibits transcription elongation. Multiple alternatively spliced transcript variants encoding two distinct isoforms have been identified.
Form : Liquid
Molecular Mass : 38.060kDa inclusive of tags
AA Sequence : MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSG TIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYK VRYTNSSTEIPEFPIAPEIALELLMAANFLDC
Purity : Proprietary Purification
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
Storage Buffer : pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.
Gene Name TCEB1 transcription elongation factor B (SIII), polypeptide 1 (15kDa, elongin C) [ Homo sapiens ]
Official Symbol TCEB1
Synonyms TCEB1; transcription elongation factor B (SIII), polypeptide 1 (15kDa, elongin C); transcription elongation factor B (SIII), polypeptide 1 (15kD, elongin C); transcription elongation factor B polypeptide 1; SIII
Gene ID 6921
mRNA Refseq NM_001204863
Protein Refseq NP_001191792
MIM 600788
UniProt ID Q15369

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TCEB1 Products

Required fields are marked with *

My Review for All TCEB1 Products

Required fields are marked with *

0
cart-icon
0
compare icon