Recombinant Full Length Human TCEB1 Protein

• Cat.No.: TCEB1-521HF
• Product Overview: Recombinant full length Human TCEB1 with N terminal proprietary tag; Predicted MWt 38.06 kDa.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Protein Length: 112 amino acids
• Description: This gene encodes the protein elongin C, which is a subunit of the transcription factor B (SIII) complex. The SIII complex is composed of elongins A/A2, B and C. It activates elongation by RNA polymerase II by suppressing transient pausing of the polymerase at many sites within transcription units. Elongin A functions as the transcriptionally active component of the SIII complex, whereas elongins B and C are regulatory subunits. Elongin A2 is specifically expressed in the testis, and capable of forming a stable complex with elongins B and C. The von Hippel-Lindau tumor suppressor protein binds to elongins B and C, and thereby inhibits transcription elongation. Multiple alternatively spliced transcript variants encoding two distinct isoforms have been identified.
• Form: Liquid
• Molecular Mass: 38.060kDa inclusive of tags
• AA Sequence: MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSG TIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYK VRYTNSSTEIPEFPIAPEIALELLMAANFLDC
• Purity: Proprietary Purification
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
• Storage Buffer: pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.

Gene Information

• Gene Name: TCEB1 transcription elongation factor B (SIII), polypeptide 1 (15kDa, elongin C) [ Homo sapiens ]
• Official Symbol: TCEB1
• Synonyms: TCEB1; transcription elongation factor B (SIII), polypeptide 1 (15kDa, elongin C); transcription elongation factor B (SIII), polypeptide 1 (15kD, elongin C); transcription elongation factor B polypeptide 1; SIII
• Gene ID: 6921
• mRNA Refseq: NM_001204863
• Protein Refseq: NP_001191792
• MIM: 600788
• UniProt ID: Q15369